Well maybe because he wants to try a life hack of not spending a single penny to buy something and instead take something from them for free in case the other people doesn’t want to get in trouble or fined for a huge amount of money. Junior is such a spoiled little kid who doesn’t care about anyone than himself. That’s what he became in 2018-2019-2020-2021 like cartman to be exact. And same goes to Jeffy.
@woe jojo I would say the same thing to him. His animation Help! Made me became an awesome artist! I thank you for bottom of my heart for making me into an anime artist 💖 @Skrumpii
@Naurto Uzamki it really isn't, if your dumb enough to read the comments before finishing the video, that's your fault also this is a plush video on youtube not some anime so "spoilers" dont apply its pretty predictable
@N N ....do you not how house payments work...? Mario owes Goodman money because Goodman sold the house to Mario despite not having enough money, so thereby Mario LEGALLY OWES Goodman money but sure, if you owe the bank money and the bank comes to collect their money, their just bad people
@Leeyah Pmoore *you and what does that even mean? I said your video is shitty and you said "u" that makes no sense almost like your videos and the reason you posted them STFU you fricken 8 year old brat
@Alakazamlover4 okay that's a good point... I mean it's a but more in Richards character but then again it's for Richard so I guess it's the thought that counts
@Liam da Lemon! yea exactly, Goodman is cheap and he hates spending or getting money, because he HAS millions! anytime Mario fucks up and he's like "what do you want, money?" goodman says "i have enough money" so why the hell would he sue someone and add to that wealth when he could just a system his kid wants (thereby shutting his kid up) and not having to spend a penny on the PS5 could he have used the money he got from the law suit to buy a PS5 and broke even? yes but back to the point earlier; he hates spending money
@YRN Kells you horrible at doing videos you roblox playing person your a noob on all the games you play because your like d1 kellz mommy can you please get me robuxs please Your mom NO YOU ARE BROKE D1 kellz crys
@Tommy Gjonaj stop being so rude. That's not nice at all. We all have a heart...come on now...let's all spread some positivity..we're better than this..❤
@Xx_Javier83_xX based on what? There is no info to prove that that. It was probably logan just rushing to get the video done and was to lazy to record him going to juniors and then Cody’s
“Cookie Crisp, Cookie Crisp” “Ba Ba Ba Ba ba I’m Cookie Crisp I’m Cuckoo for Cookie Crisp!,They’re magically delicious,they’re magically delicious, Silly rabbit! Cookie Crisp is for breakfast! The cereal that smiles back, they’re dangerously cheesy,you can taste the rainbow, I’m a Cookie Crisp now! Like a good neighbor, Cookie Crisp is there! Cookie Crisp gives you wings! Give me a break, give me a break of that Cookie Crisp!,finger lickin’ good!,they’re gr-r-reat!,Oh Yeah!,We have the meats,Have it your way!, Cookie Crisp you’re in good hands!, Cookie Crisp Cookie Crisp,Ba ba ba Ba ba, I’m Cookie Crisp, i’m cuckoo for Cookie Crisp, they’re magically delicious,they’re magically delicious,silly rabbit! Cookie Crisp is for breakfast!”
You may not see this but u love you your amazing keep up the great work Logan I love the whole cast you guys got the best videos u make me happy when I’m down so I love you keep the good work uo
It’s sad how the newer generations will never know how good these videos were, Jeffy cursing every second, the pillow fort, Cody’s saga over ken (broken, taken etc). Junior and Cody being locked in a pantry, the toilet burger that made bowser a zombie, chef Peepee the robot
@xurects Oh the Mama Luigi era, such simpler times. I did watch some of them when they were still available on the main channel, but not as frequent as Junior. Never really liked Jeffy tho lol
4:12 I like when junior was like foot long sounds like something you like and when Joseph said right dude was so funny to me (also I love SML it’s actually my Initials lol.
I really like your videos but you have five times but Ashley I like your videos super much in Ashley my name is Parker yes sir lol really like your videos in Ashley was your name
Cuckoo for Cookie crush the magic wizard cookies give me a break give me a break of that cookies good they're great oh yeah they have the meat because you're good bubble bubble I'm cooking Chris
I'm cuckoo for Cookie crisp. the magically delicious. cookie crisps gives you wings. give me a break give me a break of Cookie crisp. finger licking good they're great. oh yeah they have their meats. Cookie crisp you're in good hands. Cookie crisp cookie Crisp bubba bubba bubba I'm cookie crisp.
Video Idea: Brooklyn T Guy's Divorce Similar to A Day In Brooklyn T Guy's Life, Brooklyn Guy divorces Karen from getting to annoyed to the point he loses it.
I remember when I was little I just found a box of cookie crisp at the store (I’m British as well) and they used to have a different box I think a while ago, and I loved it
SML idea: Bowser the actor Bowser goes to an audition for a role of extra in Charleyyy and friends, and he gets it. But his fan side makes him get into very funny situations Please like so Logan can see it
17:58 aren't you also the CEO of cookie crisp because you're the CEO of Lucky charms and lucky charms is owned by general mills, general mills also owns cookie crisp so that makes you the CEO of cookie crisp
I like how the police man gave the PS5 at Jr house and police said I know where it is I gave it to them and he KNEW EVERYTHING THAT HAPPENED HE KNEW THAT CODY TOOK THE PS5
Within the assembly, many people were repeatedly interrupting the others who were talking without having the conch. Throughout the assembly, Jack talked over many people without the conch in his possession. He continually kept breaking the one firm rule they had.
To this day im still wondering how tf brooklyn guy knew the ps5 was at codys when they were all at junior's when he gave them the console, it bothers me so much someone please have an explanation cause i think logan made a mistake when making this video
@Hiretothgether mshohoho here’s a message..... 🎵 Stop promoting your own channel in the comments dude it doesn’t work just bad Business when you see someone promoting their own channel in the comments just mark it as spam cause thats Exactly what it is🎵
you’re serious getting subs this way is a poor strategy you’re always going to get reported and then get told shut the fuck up 🤦♂️ Edit: do you wanna know something if you get reported and banned by the creators people won’t be able to see your comments anymore
ooooooooooooooooooooooooo Mine r 1.Trix 2.Lucky Charms 3.Peeps Cereal and lastly a cereal that i call Purple Cereal Prob more that i cant remember atm ( i dont know why i shared this )
I remember in the magic lamp video, Junior made a wish that all the food in the world to be cookie crisps and a lot of people were dying and getting diabetes because of only eating cookie crisps
The implication was that the boys should be afraid of one another because the only danger they faced was from other guys. Each boy was distinct and had various variances among himself. The boys' lives became more difficult as a result of this personality conflict and the lack of an authority figure. Fights and arguments continue to erupt, and they are becoming increasingly violent. The guys have already decided not to follow Ralph's directives or rules, despite the fact that he has been designated as their leader.
Lyrics: A and B: "Cookie Crisp Cookie Crisp A: Ba Ba Ba Ba Ba I'm Cookie Crisp. B: Wait that's McDonald's. A: I'm coo coo for Cookie Crisp, B: That's Coco puffs A: They're Magically Delicious, B: T-That's Luck charms, A: they're Magically Delicious, B: what? A: Silly rabbit, Cookie Crisp is for breakfast. B: Ok that was Trix. A: The cereal that smiles Back, B: Goldfish. A: they're Dangerously Cheesy, B: Cheetos. A: You can taste the rainbow, B: that's Skittles. A: I'm a Cookie Crisp Now. B: H-HUGGIES!? A: Like a good neighbor, B: what? A: Cookie Crisp is there, B: State farm? A: Cookie Crisp Gives you wings, B: Red bull? A: Give me a break, B: what? A: Give me a break of that Cookie Crisp. B: KitKat? A: Finger licking good, B: KFC. A: They're Grreat. B: Frosted flakes? A: OH YEAH, B: Kool-aid? A: We have the meats, B: Arby's? A: Have it your way, B: Burger King? A: Cookie Crisp your in good hand. B: Allstate? (Sing at same time) A: Cookie Crisp, B: n-no no guys shut up, A: Cookie Crisp, B: n-no guys we can't do this this is stealing, A: Ba Ba ba ba ba, B: See this is clearly McDonald's this is stealing this what I'm talking about no guys we're gonna get in trouble, we can't keep stealing. A:i'm Cookie Crisp, I'm coo coo for Cookie Crisp, B: No, No it's Coco puffs guys, A: they're Magically Delicious, B: Ok look guys I don't want any part of this I'm leaving. A: They're Magically Delicious, Silly rabbit, Cookie Crisp is for breakfast."
Lyrics: A and B: "Cookie Crisp Cookie Crisp A: Ba Ba Ba Ba Ba I'm Cookie Crisp. B: Wait that's McDonald's. A: I'm coo coo for Cookie Crisp, B: That's Coco puffs A: They're Magically Delicious, B: T-That's Luck charms, A: they're Magically Delicious, B: what? A: Silly rabbit, Cookie Crisp is for breakfast. B: Ok that was Trix. A: The cereal that smiles Back, B: Goldfish. A: they're Dangerously Cheesy, B: Cheetos. A: You can taste the rainbow, B: that's Skittles. A: I'm a Cookie Crisp Now. B: H-HUGGIES!? A: Like a good neighbor, B: what? A: Cookie Crisp is there, B: State farm? A: Cookie Crisp Gives you wings, B: Red bull? A: Give me a break, B: what? A: Give me a break of that Cookie Crisp. B: KitKat? A: Finger licking good, B: KFC. A: They're Grreat. B: Frosted flakes? A: OH YEAH, B: Kool-aid? A: We have the meats, B: Arby's? A: Have it your way, B: Burger King? A: Cookie Crisp your in good hand. B: Allstate? (Sing at same time) A: Cookie Crisp, B: n-no no guys shut up, A: Cookie Crisp, B: n-no guys we can't do this this is stealing, A: Ba Ba ba ba ba, B: See this is clearly McDonald's this is stealing this what I'm talking about no guys we're gonna get in trouble, we can't keep stealing. A:i'm Cookie Crisp, I'm coo coo for Cookie Crisp, B: No, No it's Coco puffs guys, A: they're Magically Delicious, B: guys look I don't want any part of this I'm leaving. A: They're Magically Delicious, Silly rabbit, Cookie Crisp is for breakfast."
I just realized something When Brooklyn guy When Brooklyn guy Makes the cookie crisp Commercial The I'm an apple tree kazoo Solo From the 3 little pigs video And the little boy who cried wolf
I think you should keep the PlayStation 5 Joseph no one goes to his trailer Anderson doesn't have any electricity and Joseph doesn't have any electricity Cody Cody's dad is probably going to take it and Bowser Junior they're always at Junior's house so I think junior said keep it
@Toad manz he wished for everything he touched to turn into Cookie Crisp and he turned Thomas and chef pee pee and a bunch of stuff. I don’t remember the episode but I remember some parts
@uncessor 1 I don’t use autocorrect I just know how to put proper punctuation and proper spelling. 2 you literally play roblox so idk why u getting at me for playing fortnite.
@MilkJugs i play roblox like once every few months just for 1 game, i usually play valorant and rust, 2 u didnt even use correct punctuation in your paragraph lmao
Why did Cody, Junior and Joseph angry about who gets it since all of them can go to Junior’s house always every day they can go there and they also play multiplayer if they have enough money to buy two more controllers.
I was just watching sml pokemon series then i get to the end of part seven and i start to get annoyed because you guys said at the end of the video that it was to be continued so i search it up and there is no part 8 so am now really annoyed.
Logan , Can you plsssssssss make a day in a life of Mr.Goodman plsssss, people want you to make it , and I do to . What if he is actually poor ! Thanks so much if you will make it .
Ok first theres no way hes actually poor second they have recorded mr. goodmans house and I agree but I'd enjoy a house vid more but definitely one or the other
This doesn't really make sense because when Brooklyn guy says he's going to get his PS5 back he goes straight to Cody's house but he gave the PS5 to Junior
The funny thing is, is that when I was in a group for a made up commercial for my drama class, I was put in a group with people who wanted to make this highly inappropriate ad (it was for school). So I refused to be part of the ad and just offered to film some stuff for them. I talked to my teacher because I was scared she wouldn’t give me a good mark but she gave me a 10/10 because she felt bad. So I guess what I’m saying is that Cody also earned that PS5 because he was in a group with his stupid friends lol. But I really love all of these videos lol
@Lewis Johnson no he didn’t, I like his reaction to what Junior and Joseph were singing, without the Cody the song would be worse, this song this probably my favorite sml song
{Bowser Junior} Let me tell you about the best motherfricking cereal you can buy
{Cody} What is it, Junior?
{Bowser Junior} Well, it’s these cookies that you get to eat for breakfast
{Cody} For breakfast?
{Bowser Junior} Yeah, for Breakfast
{Cody} What’s the cereal called, Junior?
{Bowser Junior} It’s called, “Cookie Crisp”
{Verse: Bowser Junior and Cody} Cookie Crisp Cookie Crisp Ba da ba ba bah, I’m Cookie Crisp (Wait, that’s McDonald’s) I’m cuckoo for Cookie Crisp (That’s Coco Puffs) They’re magically delicious (That’s Lucky Charms) They’re magically delicious (What?) Silly Rabbit! Cookie Crisp is for breakfast! (Okay, that was Trix) The cereal that smiles back (Goldfish) They’re dangerously cheesy (Cheetos) You can taste the rainbow (Yeah, that’s Skittles) I’m a Cookie Crisp now (What? Huggies?) Like a good neighbor (Wha-? What?) Cookie Crisp is there (State Farm?) Cookie Crisp gives you wiings (Redbull?) Gimme a break (What?) Gimme a break of that Cookie Crisp (Kit Kat?) Finger lickin’ good (KFC?) They’re great! (Frosted Flakes?) OH YEAH! (Kool-Aid?) We have the meats! (Arby’s?) Have it your way (Burger King) Cookie Crisp, you’re in good hands (Allstate?)
{Chorus: Bowser Junior and Cody} Cookie Crisp (No, no! Guys, guys, shut up!) Cookie Crisp (No, no! Guys, we can’t do this! This is stealing!) Ba da ba ba bah (This is clearly McDonald’s This is stealing, what I’m talking about) I’m Cookie Crisp (Guys, we’re gonna get in trouble We can’t just keep stealing-) I’m cuckoo for Cookie Crisp (No! No, it’s Coco Puffs!) They’re magically delicious (Okay, look, guys I don’t wanna have any part of this I’m leaving) They’re magically delicious
{Outro: Bowser Junior} Silly Rabbit! Cookie Crisp is for breakfast!
It seems obvious that drinking Red Bull will not actually “give you wings” as stated in the company's famous slogan. ... The case is based on a similar US class action settlement filed in 2013 by a pair of consumers who claimed that drinking Red Bull does not give you “wings” or result in improved performance.Aug 22, 2019
The song when Brooklyn guy is on the tv commercial in the background very quiet is the same song Cody sings to in his apple tree song sml movie three little pigs
Fun Fact: The part that junior was trying to get the ps5 back and brooklyn guy trying to hit him with a hammer is called Murder Be The King its a game where a guy is trying to kill the king so that he/she is trying to be the new king if the guy got caught trying to kill the king then he/she has been thrown in a dungeon.
Then how about this Talking about Logan and what he's doing How old you are you quit talking to people like that that's with before you need Be honored and thankful
I want a MG you guys are the best you have should make a video where jeffy becomes evil like he starts breaki
ng the door and Why do you have to be so rude to Logan and his friends and stuff you always say why is son don't do that I don't talk to someone like that loser You guys I like the People in the world
Sml idea The Camp trip: So Mario and bowser want to spend time with jeffy and junior so they went to go camping and chef pee pee went to and they were going to make smores but they needed wood for the fire and jeffy went to go get wood and he got attacked by a tiger and Brooklyn guy is hiking and saw jeffy getting attacked and threw sticks and rocks at the tiger and ran away so Logan please do it please.
For the sml question my favorite cereal is cheerios because it has a hole and jeffy likes cheerios so yeah and then you know what to do with the hole 😏
Cody is right they literally copied McDonald's Lucky charms Cocoa Puffs kit Kat goldfish Pizza Hut Trix Skittles Cheetos Huggi's State farm Red Bull frosted flakes etc. So it makes sense why they got sued in the end well for some reason Brooklyn guy almost got sued not Junior but still it makes sense why they ALMOST got sued I wish Cody was there to rub it and Joseph and Junior's faces of how stupid it was to copy all those companies
First of all you still said cookies that you can eat for breakfast, secondly what’s the slogan again? And third and least important is that it’s all copied honestly that last one shouldn’t be there
Sml idea: bowser watches charlie and friends as usual and then charlie meets his biggest fan its not bowser so bowser meets up with him and finds a way to proove to charlie that hes his biggest fan
SML Movie Idea: Goodman goes Bankrupt! After losing his job on the news due to the rise in the cough cough cases, Goodman has no other option but to sell all of his other businesses because he can no longer afford them. So, he has to move in with Mario! And to Mario's surprise, theres a lot more to Goodman than a house payment collector.
@Greg the Unicorn Well, his kids might get taken off him from social services 🤷♂️. I mean, I'm sure they'd have questions if the kids were literally pooping gold bricks and money. Anyone in the right mind would be concerned. It's not being dumb, it's being creative. Having an imagination - an imagination is clearly something that you don't have.
Yeah but the Cookie crisp song was a bunch of slogans that you mixed together and you copied people they did that because they need a company you don't need a company you just want to Xbox just copying off of somebody song and lyrics Why are you doing something instead doesn't belong to you boy that isn't what Junior have to do you understand being smart okay and Kobe shouldn't be gay if I watch this one more time
SML don't do that about vegetables vegetables bring nutrients and they are really good for the environment but you are what's wrong with Society and if you're wondering how I got to that part I would just given everything to see how what happened but flip you sml
@Claret And Blue⚒️ he just spoke facts the vids are only gonna revolve around the two main story characters and it wouldnt happen I think we all know it would be nice to have woody returns tho hes not hating
I cant stop laughing!!!!!!!!!🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣
How is y’all gonna say that Cody held the camera when he was the one in the video singing with junior Joseph was holding the camera because he wasn’t even in the video so that scene didn’t make sense at all also Joseph don’t even have electricity so how the hell is he gonna play it at his trailer y’all don’t think think before you speak or record
Goodman could have just bought another ps5 he has like millions so he cwn buy enything to be ohnet and i dide t even know the mac advert went like bubububaba im macdonalds like LOL HAHAHA LOVE UR VIDS btw im a big fan i try stoping my selff from ur vids beacouese my mom and dad td me to but i do it enyway beacouse i cwnt stop myself im a BIGGGGGGGGGGGG FAN LOVE UR VIDS DO YE kh and. If u do shout outs pls let me be one of 3m love jr vids i say that alot but ye!!!:)
So... is no one going to remember the time when Junior wished for everything to be cookie crisp? Because this is more or less like the sequel for it xD
@IanKava your banner says AlienZGamer, so that story is incredibly hard to believe. Not only that, but I’ve seen many comments like yours from different channels. And also, what will subscribing to you do? That only gives you dead subs, which is terrible for the algorithm. If you need subs that badly, try this concept called making videos that people can watch without dousing themselves with gasoline. Quit your bullshit.
@Jonghyeon09 that’s your opinion if you have nothing nice to say don’t reply And If Your Just Gonna Call It “Bad” Be More specific tell him why it’s bad and what he can do to make it better
I love this video so much I would actually really love this place and I love all of the SNL videos it’s just perfect and I like when it said cookie crisp time cookie crisp time
Did anyone notice that when Brooklyn t guy gave his ps5 to Junior and he what’s it back he randomly knows that the ps5 is at Cody’s house when he gave it to Junior
Junior said that I'm going to sing with my beautiful voice but he thinks that he's only going to get the ps5 and he said that he is only going to play it for 6 years but bruh thats a long time he just wants to keep it for a long time.
jr: bruh chef peepee get out my home chef peepee: hell no Jr friends came:sup Dude chef peepee: uhhh yeah I will cook you some cookie Chris Chef peepee Whispers : do not tell your friends to kill me jr: ok fat boy Cody: wats going on jr are you saying your going to sleep or wat? cody: my baby is sooo gay like me Joseph and Jr: he's a doll dude Cody: he's not a doll Joseph: yea he is cody Jr: 1 2 3 jr and joseph:HE'S A DOLL DUDE!!!!
Wait if Joseph thought about that isn't he homeless so does he have a TV how does he have enough money he is homeless how does he know all of those commercials so how does he have a TV cuz he's homeless it doesn't make sense right whoever sees this
I know a lot of people have already forgot, but we do realise whenever Joseph or another character says or calls Joseph's poor or anything related to it, just don't know about rich Joseph.
Sml idea The king of shrimps Mario is eating shrimp fried rice when woody walks in with a gun and shoots mario who was a shrimp in disguise and the shrimp hisses at woody and goes away down a sewage drain and woody follows the shrimp in a shrimp costume where woody finds out there is a shrimp hq in the sewers where woody finds the King of shrimps Shrimpo senior the first who sees woody and tries to kill him but woody dodges and the shrimp king gets stuck in a pipe and woody pulls out a fork and eats the shrimp king and throws a hand grenade at the base and the hq explodes but a defence league of shrimps follow woody and woody knocks with a boxing glove Logan can make up the rest
Logan I have a SML Movie request since you already did The life Brooklyn Guy I was watching old SML videos and I seen Mr. Goodman as a cop and I was wondering how did he become rich.
@Darien Webster do you want. Yay for the update on new update. Wolf. Yay yay lol I just saw it on the way lol I love the one I want lol I think it’s funny how it looks lol lol I think lol I was
SML Idea: The time portal! Junior has a bad day and then Cody makes a time portal but junior goes in it back to the morning and has to relive all the bad things.
SML idea: bowser jr. has to have a baby sitter, and his dad gets in a car crash with chef pee pee and the baby sitter tells him the bad news and he has a mental break down and he tell his friends
This is my idea for a video one day.there should be a cookie crisp vs tricks and junior likes cookie crisp but Cody likes tricks then they have a big argument about there cereal then they try to tell each other that there cereal is better then they agree to eat each other’s cereal to see how’s cereal then Cody eats cookie crisp and he likes it then junior eats tricks then he likes it then junior and Cody are friends again.so that’s my idea and I hope you read this Logan and I love your video’s l won’t to se this video in the future please 😊😊😊
Juan Castillo2021-08-30 17:15:36 (edited 2022-02-02 21:02:59 )
Browser Jr: But Chef Pepe, I Want To Eat Cookies Crip For Breakfast Please? Chef Pepe: No Browser Jr, You Have To Eat Vegetables Because It’s Healthy And Good For You So Deal With It! Besides, Cookie Crip Is Bad For Your Health And Make You Fat! Browser Jr: But Chef Pepe! Chef Pepe: No Buts! Eat The Vegetables Or I’m Tell Dad You’re Get Grounded!
Could be grasped Cookie Craft tresper McDonald's cuckoo for Cookie Crisp they're magically delicious smiles back the rainbow Chris was there give me your heartbreak give me your breakup. Cookie Crisp
This was like that time me and two of my friends and other people we had to make wooden drop rides and we put eggs in them so me and my two friends did all the wood frames the walls the mechanisms while the other guys made stuff we weren’t even gonna use and we had to pick lolli sticks to see who would keep it me and my two friends agreed whenever we went to the park we would give it to the next person but the one kid he didn’t do a single spec the other kids did like a tiny bit but the kid who did nothing got the drop ride I went mad and he still has it till this day 2 years ago that was nearly 3 years
sbl idea; the comeback tbh not sure what to name it but plot : Junior and Cody get a call from their kids ( chef pee pee's kids ) and they don't know the number, once they answer it they hear the kids' voices and realize, jr & cody talk to their kids, asking how everything's going then Chaz talks about how he got a masters degree in college, and how hunky he is, then starts talking about his gf. Cody gets pissed off and talks about how Chaz was supposed to be gay like his father. (im not very creative tbh, you can add more) Anyway jr jr, talks about how he's a 5-star cook for a rich guy (Mr.Goodman), and talks about how he gets 100 dollars an hour. Then all 4 of them (maybe include joesph) talk about them coming over to their house, and they ask jr jr to make a meal for them, bowser comes down and gets served a bowl as well, jr jr cooks a steak with a side of vegtables and bowser wants jr jr to replace chef pp, and chef pp gets pissed and wants to have a cooking battle with jr jr, chef pp makes his famous old recipe (the bet vid), while jrjr makes bowls of mac n cheese, chef pp calls it too simple then when everyone tries it they love it. Bowser wants jrjr to cook for them, but he denies as he has to cook for goodman, meanwhile cody meets chaz's gf and actually starts to like her
this is all i have im getting so confused writing this, i had a plot 2 but this is gonna take way too long but basically cody, joesph, and jr go outside and see their kids while outside you can make the rest of the plot im so tired
@Jumpz I know. Your is the correct word to use because “You are spelling is bad” It’s meant to be “Your spelling is bad” because “Your” is when you’re talking about about another person’s things like their spelling. In conclusion, you’re all idiots.
@IanKava your banner says AlienZGamer, so that story is incredibly hard to believe. Not only that, but I’ve seen many comments like yours from different channels. And also, what will subscribing to you do? That only gives you dead subs, which is terrible for the algorithm. If you need subs that badly, try this concept called making videos that people can watch without dousing themselves with gasoline. Quit your bullshit.
Wow that's a record great job. Man i would love to see jr puts on a kane mask and jest like the movie mask except the funny part jest jr fights his friends and family👍👍
They stole a lot of companies like Bing thing they just like a lot of stuff from a neighbor took the Bubba Bubba Bubba from McDonald’s they took the Pizza Hut they took subway thanks a lot of stuff equipment company
They stole a lot of companies like Bing thing they just like a lot of stuff from a neighbor took the Bubba Bubba Bubba from McDonald’s they took the Pizza Hut they took subway thanks a lot of stuff equipment company company
Yo Logan can we get the chef pee pee goes crazy SML Movie: where chef pee pee goes crazy after working for bowser for a long time and he turns into turtle soup
The Real OGS remember when Logan used his Mario Wing Cap Plush to Show His Cats,Videogames,Nintendo Merchindise,Shrimpo Hunter,Toad Rap Song,MLSDA,Mama Luigi And Tony The Tiger
How is that an og?? Surely it would be in the old house if your an original watcher.. this is what went wrong with super mario Logan.. he was pretty much forced to become a more like kids channel.. and now has a kid fanbase..
OG’s? Wasn’t that episode a year and half ago in 2019. Or is this a different episode you’re talking about and I’m not a real OG so I don’t get the reference.
Fun Kids2021-02-04 02:30:46 (edited 2021-02-04 02:31:15 )
Sml Idea: Kidnapped Mario tells Bowser & Chef Pee Pee that they have to take Junior & Jeffy somewhere with them, but there's something terrible that might happen.
Junior: wow cody, your so selfish and so greedy that you hid the PS5 so you can hide it for yourself says the guy who tried to change the rules cause things didn’t go your way
0 likes
D On Gfuel2021-08-15 02:11:04 (edited 2021-08-15 02:11:45 )
when i saw the comment why did goodman take the ps5 he could buy millions of them made me mad because i hate goodman i hate scooter the most but i hate goodman second
Just Do It (Nike) New New New New (Cartoon Network) We are Cookie Crisp (Farmers Insurance) What Would You Do For a Cookie Crisp (Klondike) It’s like preschool on TV (Nick Jr.) Cookie Crisp has rrridges (Ruffles) Get Cookie Crisp, save less (Walmart) Open Happiness (Coca-Cola) What’s In Your Wallet (Capital One) America Runs on Cookie Crisp (Dunkin’ Donuts) Cookie Crisp is our Recipe (Wendy’s) Nobody Better Lay a Finger on my Cookie Crisp (Butterfinger) I Want My Cookie Crisp (MTV) Am I missing anything?
Jesus was crucified , bore our sins in his body, he rose from the dead in 3 days, trust in him and gain eternal life. Without him we are lost..........
Cookie Crisp Cookie Crisp Ba da ba ba bah, I’m Cookie Crisp (Wait, that’s McDonald’s) I’m cuckoo for Cookie Crisp (That’s Coco Puffs) They’re magically delicious (That’s Lucky Charms) They’re magically delicious (What?) Silly Rabbit! Cookie Crisp is for breakfast! (Okay, that was Trix) The cereal that smiles back (Goldfish) They’re dangerously cheesy (Cheetos) You can taste the rainbow (Yeah, that’s Skittles) I’m a Cookie Crisp now (What? Huggies?) Like a good neighbor (Wha-? What?) Cookie Crisp is there (State Farm?) Cookie Crisp gives you wiings (Redbull?) Gimme a break (What?) Gimme a break of that Cookie Crisp (Kit Kat?) Finger lickin’ good (KFC?) They’re great! (Frosted Flakes?) OH YEAH! (Kool-Aid?) We have the meats! (Arby’s?) Have it your way (Burger King) Cookie Crisp, you’re in good hands (Allstate?)
I laughed so hard when tyrone was about to answer the door and he opened it Brooklyn guy said hey there sir Tyrone freak out he said ahhhh it’s the cops😂🤣😆🤣😂😆
He wants a bird but he can't afford one because he's poor so he's treating himself like a bird and eat like a bird and chirps sometimes and other bird stuff
When Junior is singing a song, Cody thinks that Junior mess up the song. It is because he stole ideas from other companies and that song is going to get sued. Cody knew that this song is sued because Goodman is the CEO of other companies and thinks that they stole other ideas.
@Dob I don't get how this works. You CAN make parody work and transformative work. It's part of the Copyright law. Nintendo is just a super hypocrite and likes to sue and shut down everybody. They sued a popular ROM site for NES games for millions of dollars. Then used those same ROMs to sell them on their stupid mini consoles.
I have a video idea that Jackie chu goes on holiday and goodman takes over the class . Then Jeffy is really bad for good man so goodman says to mario if jeffy can be good in class he will pay of his house and in the last minute of school jeffy does something bad
Why did Junior win a PS5 again? Didn’t he won one already in “The Candy Salesmen” or someone accidentally opened the door which let Jackie Chu inside the house to take away all for the rewards that Junior and his friends got including the PS5 because he must have continued knocking the door. However Cody is the one who gets to keep which is fair.
Okay sharing this: this was playing on my school laptop and I forgot to take the tab off and then I took the chrome book out of the case opened this and this played and I was so embarrassed 🙈
OMG....lol AT THE END OF THE DAY KIDS LOVE COOKIES SO OBLISLY KIDS SHOULD LIKE COOKIE KRISPS LOL THESES STUFF CRACK ME UP KEEP UP THE GREAT WORK LUV YA... HASTAG... PINK HEARTSSSSSS......
Imagine this video has deleted scenes when Bowser Junior wakes up and in the PlayStation 5 is gone and you're telling Joseph and Cody the PlayStation 5 and Cody was right they cover the slogans
Andy Hoang2021-07-13 03:52:13 (edited 2021-07-14 01:37:04 )
Super Mario Logan: Mr. potato head Date of birth: Jan 23 2005 Gender: male Cast: Lance thirtyacre (formerly) Lovell Stanton (in jeffy's magical pencil) Episode: food scam
0 likes
Replies (1)
Andy Hoang2021-07-13 03:52:53 (edited 2021-07-15 01:21:50 )
Super Mario Logan: Luigi Date of birth: November 26 2010 Gender: male Cast: Logan Thirtyacre (formerly) Chris Netherton (in sml movie: ghost)
0 likes
Mr. Banana2021-07-27 06:45:54 (edited 2021-07-27 06:53:25 )
I thought Jewish can’t eat bacon and Doesnt Goodman have like a couple billion PlayStation five in his house
It would have been better if it went like this Junior “ if it lands heads I get to keeps it” Junior “if it lands tails Joseph keeps it” Cody “what about me” Junior “what about you” Cody “How do I get the ps5” Junior “You don’t” Cody “ why I held the camera” Junior “because you did basically nothing
SML SMLLLL bababba im SML im SM for SML the best shop awer the best shop awer silly rappet SML the best store gimme a break gimme a break with this SML SML SMLLLLLLL bababababa im SMl i love your vids :)
Y’all fr could’ve ignored this but all of you went out of your way to spread hate on this kind person spreading what they believe in also @Issak, if literally nobody cares, what was the point of replying to their comment?
@Issak Robin Yo, stop being rude, ur just trying to be rude to this guy. Ur probably a jerk irl. He's just trying to be nice to y'all, but y'all are mad rude. Just learn how to be nice not a rude jerk.
I have Alzheimer's and you need to get the video of the video of the video of the video of the video of the video of the video of the video of the video of the video
@J.F.A Jonsson Freiholtz Adolfsson DON'T YOU EVER SAY THAT IF ANYTHING HE WOULDN'T HAVE SENT HIS SON FOR YOU TO DIE FOR YOU. If you need a hug just say that ❤️💕❤️
Man all these people are ignorant i believe in god. I get it your doing good but why in this environment of youtube. And for the people who dont care KEEP IT TO YOURSELF we dont need to here anybodys thoughts i am not bias beacuse your just causing more conflict. Just shut up we came here to watch Sml not just try to end up in drama alert.
@SUPER MARIO PLUSH CHANNEL! wouldn't that also make you a nerd for knowing and remembering?🤔 How old is that show now? And you still remember that episode
Also there might be ya know "dangerous people" here and ya might get "napped" if you're not careful so be safe kid I hope you don't learn the hard way 😅😅😅😉
@THE FORBIDDEN ONE look here something from the Bible If we confess our sins, he is faithful and just to forgive us our sins and to cleanse us from all unrighteousness.
@THE FORBIDDEN ONE it’s the end of you want to stay here and not say sorry cool bro sorry for bothering you but you also say sorry bro this is a internet fight we can’t end it SO LET’s JUST END IT
for example if a guy shoots a kid because he was mad then he prayed for forgiveness and got forgiven does that mean he don't have to go jail now because "god" forgave him
@SUPER MARIO PLUSH CHANNEL! alright kid I'm over you I'm just trying to have a nice day man why the hell you gotta be toxic I'm eating my favorite food and watching TV why do you gotta mess it up again now I don't even feel like eating
@SUPER MARIO PLUSH CHANNEL! Get ready to get expose because this whole dumb conversation leads to a ban for being racist to a black person. I'll see you in my nexts video!!! 😘😘 Hopefully you can delete the comments while you can.
Sml idea :jailbreak bowser and mario dont have money to pay the house payment they rob a gas station and the cops get them they go to prison and the kids junior joseph jeffy cody make a plan to break them out sorry if its bad
How about you have Jerry’s ceral where mario signs him up for a constraint and Jeff wins by making a cereal with a ton a sweets then it out sells Brooklyn t guys cereal and idk hopes it’s good light went I do it on a month or something cus u just did a cereal or this I this Is trash
ohhhh lmao or have one episode where JEFFY turns into a JERRY one day either he decides that to be his name or he forgets his name and thinks its Jerry or spelled that way or alternate personality or... alternate universe... ;) I know the SML crew likes that
Idea: mr Goodman’s house payment Plot: Goodman gets ready in his elephant a$$hole suit and his doorbell rings and it’s Elon musk or some other billionaire and ask for Goodman’s house payment and he can’t pay it and if he works for Mario and has to babysit jeffy and cook
Bowser Junior's All Nighter: "What about a three-sided coin?"
4-5 years later
Bowser Jr's Cookie Crisp: "And if it lands perfectly on the edge, like this, not heads or tails. It just lands on the edge. You get to take it to your house."
Why did Goodman take the PS5, he could buy millions of them lmao
4574 likesReplies (477)
https://youtu.be/yazne6gVz7I
86 likes@YRN Kells ew no
136 likesFacts
43 likesI know
28 likesBecause there is a national shortage of ps5’s
44 likes@YRN Kells Trash ass song 🗑
30 likes@Jettaboii it’s a joke chill
10 likesHello
8 likes@friendswithfortniteandkalenwithneofid ?
8 likes@YRN Kells Fukin self promoter also that autotune sucks
19 likesYea
8 likesYeah
8 likesBecause they are all sold out
10 likes@Zarccc stfu
5 likesY'all mad toxic for what
10 likes@YRN Kells i think i went death after the garbage song
12 likesTrue
7 likes@bolt_was_here yep
7 likeshi Skrumpii like your videos
8 likesIt sold out.
9 likes@YRN Kellsew
11 likesTo save money
5 likes@stinky nguyen Let me guess: it was something fake...
5 likesOMG MAKE A ANIMATION OF THIS!!!
6 likes@EEE ohhh
5 likesThanks for spoiling
7 likes@YRN Kells more autotune than Travis scott
6 likes@YRN Kells stop plugging your shitty music. Bruh.
7 likesThanks for the spoil
6 likesYeah
3 likesIt’s beacuse sml don’t have any ideas
3 likes@NeverTrustGhost to save dam money he’s a fricking billionaire
3 likesActually, he could buy Sony, because his credit limit is yes
3 likes@YRN Kells how desperate you are.
6 likesBecause there’s not many of them made
3 likes@Mathias Berry loser
5 likesOr kidnap junior and hold him for ransom for who knows how much money the companies make junior copyrighted
2 likesBruh there sold out
2 likesFor real
2 likeshow is that funny
2 likesTheir sold out
2 likes@YRN Kells what did he do. I don't want to click the link. Can someone tell me what it is
2 likesI thought the same thing
2 likes@YRN Kells stfu!
3 likesThere sold out lol
2 likesSkrumpii i love your bts and normal
3 likesAyooKellz yo song sucks
3 likes@YRN Kells Fuck you.
2 likesThey are rare and sold out
1 likei subscribe to you
2 likesCause he is rich as ####
1 likeIt could be out of stock
2 likesWell maybe because he wants to try a life hack of not spending a single penny to buy something and instead take something from them for free in case the other people doesn’t want to get in trouble or fined for a huge amount of money. Junior is such a spoiled little kid who doesn’t care about anyone than himself. That’s what he became in 2018-2019-2020-2021 like cartman to be exact. And same goes to Jeffy.
1 like@Backup Llama crazy mission complete
0 likes@YRN Kells Can u plz stop?
2 likesSkrumpiiiiiiiii omg ur the best YouTuber ever
2 likes@YRN Kells https://youtu.be/JwncAQurlqk
0 likesew poor
0 likes@LightningZ1170 cálm down
0 likes@woe jojo I would say the same thing to him. His animation Help! Made me became an awesome artist! I thank you for bottom of my heart for making me into an anime artist 💖 @Skrumpii
0 likesScalpers
1 like@YRN Kells good song
2 likes@Akwaman08 it’s a song
1 likehttps://youtu.be/O77XlKNsgEI
0 likeshttps://youtu.be/O77XlKNsgEI
0 likeshttps://youtu.be/O77XlKNsgEI
1 like99% of y’all won’t see this but I hope you’re having a great day🥰
2 likesI’m a small content creator & make videos & it’s my dream goal to get to 2k of yt friends for my birthday in February❤️
That’d mean alot to me if you can check my channel out☺️❤️
@YRN Kells go away
1 like@Evan Phan yeah i hate those
0 likes@Nona Reacts bot shut up nobody cares and stop self promoting
1 likeGoodmans cheap
0 likesSpoilers
0 likes@YRN Kells idc
1 like@YRN Kells stop
1 likeIkr Skrumpii
0 likes@YRN Kells no one give a shit
1 likeWelp thanks for spoiling it
0 likes@kieraa ur welcome
0 likesIf anybody would do me a favor and please sub to my YT? First couple subs get entered in a giveaway!
0 likes@Sketty no one gives a shit fortnite kid
1 like@Astro Jesus Christ gg bro, you insulted me, great job 👏
0 likes@Mazakuti everything 😐
0 likes@YRN Kells that shit you shit is hot .
1 likeHot garbage 🗑
Exactly but they needed a ending I guess
0 likes@YRN Kells stop self promoting
1 likeIdk
0 likesNah he owns playstation
0 likes@bolt_was_here deaf*
0 likes@Mr. Dime-Stealer whatever you fool
0 likesEWW POOR
0 likes@SuperSavageBros64 ...
0 likes@bolt_was_here hey man, calm the fuck down, I was only trying to help, I can’t stand self promoters myself either
2 likesWhy didn’t Goodman just buy the Cookie Crisp company
0 likesWow y’all need to chill he is promoting himself that’s what Logan did so all of y’all stfu
0 likesThey are not in the country
0 likesCause he wouldn’t waste money on consoles and uses it for businesses
0 likesYou know their sold out and tbh idk how Brooklyn guy got one
1 like@YRN Kells shitty video from a shitty youtuber :D
1 likepro shooters wrong person
2 likes@YRN Kells ewww
2 likesbecause a bunch of people buy them so there's none left
0 likes@Husky_Hayden but he's goodman so he can find one
0 likes@Jettaboii scalpers
0 likesthey r sold out
0 likes@fortnite memes and other random stuff *Are
0 likesSpoiler
0 likes@Naurto Uzamki it really isn't, if your dumb enough to read the comments before finishing the video, that's your fault
1 likealso this is a plush video on youtube not some anime so "spoilers" dont apply its pretty predictable
Exactly
0 likes@Hypercinos exactly
0 likesIt's hard to get them
0 likesI have idea:
1 likeBowser jr's Revenge
Plot: After Junior got his ps5 taken by Mr Goodwin He decide to steal the PS5
@Zaquarvious Gaffney why are you posting a plot idea as a reply to another comment? logan will never see it here
0 likesBut there's barely any ps5's
0 likesCause it’s been sold out
0 likesLazy
0 likes@Sasori Dont ask why hes alive.. i know you are
0 likesFR OMG
0 likes@QuarantineShadow For real
0 likesthey were probably sold old in the country / region whatever, or probably he would get scammed,
0 likesmy dad still managed to get a ps5, it was probably the country was still in stock
Skrumpii im subbed to u
0 likes@YRN Kells idc
0 likes@YRN Kells Imagine self promoting in the comments of a normal video
1 like@bolt_was_here Sorry to ruin your roast, but it’s “deaf”
1 like@YRN Kells I took a look at your channel, YOU DO THIS ON EVERY VIDEO YOU WATCH?!?!?!
0 likeshe jus selfish &’ greedy
1 like@Frosty its ok
0 likesAyooKellz ew poor people videos
1 like@YRN Kells boo
0 likes@bolt_was_here You mean deaf
0 likes@Kami SOMEONE SAID ALREADY STFU
1 likeI know right!
0 likesHi
0 likes@Evan Phan
0 likesZyien
@bolt_was_here
0 likesAss
D
0 likes@Joy Wilson shut up bitch
1 like@Alakazamlover4 Who?
0 likes@YRN Kells your song 🎧 isn’t nice so no 👎🏻 F*CK NO!!!!!!!!! 🤬🤬🤬
1 like@Sasori Dont ask why hes alive.. who?
0 likes@N N ....do you not how house payments work...? Mario owes Goodman money because Goodman sold the house to Mario despite not having enough money, so thereby Mario LEGALLY OWES Goodman money
1 likebut sure, if you owe the bank money and the bank comes to collect their money, their just bad people
@N N "another" speaking as if this happens a lot
0 likes@YRN Kells BOOO YOU STINK
0 likesHe took it cause he didn’t want them to have it
0 likeshttps://youtu.be/aNOI2v5izN8
0 likeshttps://youtu.be/aNOI2v5izN8
0 likes@leballbuss dont advertise your shitty videos here kid
1 likehttps://youtu.be/aNOI2v5izN8
0 likeshttps://youtu.be/oqjMA7-eNW8
0 likes@Leeyah Pmoore what the fuck did i just watch that was so shitty
1 like@Alakazamlover4 'u'
0 likes@Leeyah Pmoore *you
1 likeand what does that even mean? I said your video is shitty and you said "u" that makes no sense
almost like your videos and the reason you posted them
STFU you fricken 8 year old brat
Why arent you verified?
0 likesmaybe the pre orders were sold out... eh sometimes he prefers to just get someone to do something for him rather than to sue them
0 likes@Liam da Lemon! its honestly in goodmans character to just take someone elses vs. get the money
0 likes@Alakazamlover4 okay that's a good point... I mean it's a but more in Richards character but then again it's for Richard so I guess it's the thought that counts
0 likes@Liam da Lemon! yea exactly, Goodman is cheap and he hates spending or getting money, because he HAS millions!
1 likeanytime Mario fucks up and he's like "what do you want, money?" goodman says "i have enough money" so why the hell would he sue someone and add to that wealth when he could just a system his kid wants (thereby shutting his kid up) and not having to spend a penny on the PS5
could he have used the money he got from the law suit to buy a PS5 and broke even? yes
but back to the point earlier; he hates spending money
True but there’s none in stock
0 likesOk
0 likesThey’re sold out
0 likesEw no poor
1 likeFacts
1 likeAyooKellz song is ass
1 like@YRN Kells guys report this🤮
1 likeSoo true
0 likesRubbish
0 likes@YRN Kells ew
1 like@YRN Kells stop advertising ur videos, 7 yr old
1 likeLol
0 likesikr
0 likes@bolt_was_here u fucking idiot it's Deaf
1 likeYOUR RIGHT LOL
0 likesTrue no cap
0 likesBecause he’s greedy lol
1 likeand he could have an extra one
0 likesHehe
0 likesFor real
1 like@AyooKellz stop self promoting you’re trash vids 🤡
1 likeYou right Mr. Goodman has lot of money
0 likesWhy goodman never buy a PS5!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!
To punish Junior.
0 likesright
0 likes@Mr.kingdice. Nicktendo: im four parallel universes ahead of you.
0 likesHey
0 likes@ghost bruh they did come up with a good ending shut up the ps5 is sold out
0 likes@YRN Kells https://youtu.be/JwncAQurlqk
0 likesRIGHT
0 likeshttps://www.youtube.com/watch?v=dvJgbYUQt-c
0 likesLol
0 likesshooters yeah
0 likes@Backup Llama crazy why
0 likes@LightningZ1170 fu u
0 likes@stinky nguyen You don’t know real music ( ͠° ͟ʖ ͡°)
0 likes@LightningZ1170 you to
0 likesYYYY
0 likesI think there not in stock
0 likesthats so true hahhahah lmao
0 likesMaybe he doesn’t wanna spend +$500 for a PS5
0 likesMaybe they were sold out
0 likesIkr
0 likes@Jettaboii he can buy it of a retailer he’s a billionaire
0 likes@Nave he can buy a overpriced one on eBay
0 likesRetribution.
0 likesYes
0 likesNo he could by BIGILLIAN PS5S
0 likesBecause buying is for poor people
0 likes𝕀𝕄𝔸𝕆
0 likesTrue
0 likes@YRN Kells uhhh ayo ik why u doing that u trying to make money dude take the real way to become a good youtube and skrumpii u true fact
0 likesBecause he’s goodman He’s rich and greedy
0 likesHi akummpii
0 likesDoes Goodman hate Mario?
0 likes@EEE nah but good man would buy one for 10 million dollars lol.
0 likesyea but ... FUCK OFF
0 likesSkrumpii They’re probably sold out
0 likesMaybe sold out
0 likesWhat
0 likes@YRN Kells that beat dum
0 likes@AyooKellz your gettibg bad from youtube from this what wrong with you everyone hate you
0 likesIm 1.1K like lol
0 likesBecause the Ps5 is Instinct
0 likes@YRN Kells no one cares this has nothing to do with the question
0 likesThere’s no more
0 likesThat actually makes a lot of sense
0 likesI think the video is going to get copyrighted for using the slogans lmao
0 likessubscribe to me right now why my video is going to premiere on power ranger dino fury The Official Premiere date reveal
0 likesHe does not like his son facts
0 likesWhy is everyone being rude to @YRN Kells yall so rude to him you know god dont like bad people ok yall be grateful for the music
0 likes@kaiju universe vs.project kaiju I just let em hate honestly cause it’s a whole bunch of keyboard warriors but they won’t be like this irl
0 likes@YRN Kells f you
0 likesikr
0 likesTru
0 likesYou guys are so rude jess
0 likesStop saying that about the song
0 likeshttps://youtu.be/o-WgKW1yf64
0 likesLol
0 likesthey just got lazy at the end
0 likesIt’s a plush video that’s the plot
0 likesCause it’s hard to find a ps5
0 likes@YRN Kells stfu u ain’t about the stuff u rappin about
0 likes@Akwaman08 it’s a horrible rap song
0 likesI know right! I want to see Mr. Goodman sue Brooklyn T Guy and make his life even more worse
0 likesYou are all so toxic for 1 mostake relax G's
0 likesI mean, could’ve been payment for the copyright.
0 likesHaha
0 likesIt's Brooklyn but
0 likesGoodman is not in the video
0 likesI was about to write this :(
0 likesBecause it's sold out everywhere
0 likes@YRN Kells self promoter
0 likesok
0 likesI loved your videos❤️
0 likesPs5s are rare
0 likesTrue
0 likesYou spoiled the end dumb ass
1 likeThe correct amount he can buy is 7.0270179207628810E+8207377298277639
0 likesits for plot convenience
0 likesGoodman Must Be Talkin About Richard
0 likesHe didn’t want to waste his money 💰
0 likesAnd
0 likes@Kidboo studios SHUT UP MEANY
0 likes@YRN Kells report him now
0 likesDo you know how hard it is to get ps5
0 likesLol
1 likeHe probably wants it for free
1 likeYa I know
0 likesHehe...
0 likesSKRUMPII!! IM A BUG FANOF U
0 likesMaybe his son wanted it now because he did not want to wait because waiting for poor people
1 likeBc their all sold out👀
0 likesBc he lazy
0 likesBecause there out of stock
0 likesWhat you do with a soccer ball
0 likeshttps://www.youtube.com/watch?v=dQw4w9WgXcQ
0 likesstfu everybody stop being mean
1 likeMaybe because he wanted to take something from them for stealing their slogans
0 likesHe probably knows he can just buy one
Why did you ruin the video
0 likesIkr
0 likescool bru- HE CAN BUY BILLIONS AND MILLIONS
0 likesNo they sold out
0 likes@YRN Kells ew no
0 likes@Axel_MineBlox r u like 6 yrs old
0 likesBecause he does not want to waste his money
0 likesWe
0 likesI thought that to ...
0 likeshttps://youtube.com/channel/UCdZSZbZTbZhOho36frgDLyA
0 likesCuz they all sold out duh
1 likesold out
1 like@PHANTOM STRIKE true
0 likesHe didn’t want Brooklyn guy to have fun
0 likesWhy yall hateing tho
0 likesIkr
0 likes@Skrumpiim EWW POOR is what he would say
0 likesYeah
0 likes@YRN Kells here do me a favor Shut ths fuck up 😌🖕🏻
0 likes@YRN Kells lmao its soo bad that its worse than the worst song ive ever heard
0 likesEvery ps5s are out
0 likesMr, goodman doesn't want to waist his money
0 likes@pro shooters he didn’t say anything mean he is chill
0 likesLOL
0 likesLmao
0 likes@YRN Kells bruh cringe
0 likesTrue
0 likes@Backup Llama crazy I did
0 likesYe cuz he's a ouddralion (srry if I spelled it wrong) aire
0 likes@GDSkulll stfu hater
0 likes@Jer. remy fuck u and shut the fuck up
0 likesSkrumpii
0 likes.....
0 likesHe Doesn’t want to give people money
0 likesU
0 likesGoodman stupid
0 likesHe never has enough NEVER. EVER.
0 likes@Nick 6ix 😂
0 likesikr 😂
0 likessold out
0 likesyo
0 likes@YRN Kells your shit at rapping bro
0 likesYeah
0 likes@YRN Kells That song's shit 😑
0 likesThey’re sold out😂
0 likesWell, because they keep getting bought, that’s why.
0 likes@YRN Kells ew
0 likessame with joseph
0 likeslol
@YRN Kells why is everyone so toxic to this guy just sayin
0 likes@Jay Jay they won’t do it in real life so I’m not tripping
0 likes@YRN Kells stop self promoting
0 likesHe didn't want to give money
0 likes@Evan Phan stfuuuu nigga
0 likes@pro shooters how about u?
0 likesYou were they first person to comment and you spoiled it!!!
0 likesFacts
0 likesHi Skrumpii I Subbed Your Channel BTW
0 likes@YRN Kells im sorry but that shit was trash
0 likesWhy you here
0 likesEvery penny counts
0 likesBecause of plot convenience
0 likesBro ther selld aut everywere
0 likesTrue
0 likesMaybe theyre sold out so
0 likes@YRN Kells your song is trash
0 likesThere sold out
0 likesTrueeee
0 likesCuz it's all sold
0 likesthey were probably sold out
0 likesIkr
0 likesMaybe he is F**** lazy
0 likesCuz it’s His ps5
1 like@Backup Llama crazy what happened it won’t let me watch it
0 likes@Erin Hildibrand srry that’s my other acc but still what happened
0 likes@卄ㄖ山ㄚㄖㄩᗪㄖ丨几Ꮆ卄乇ㄥㄥㄖㄒ卄乇尺乇 na i just upload them somewhere else and i bet you wouldn’t say this in person
0 likes@Kickable yo momma
0 likesi am not laughing, this is not funny
0 likes@Akwaman08 music video self promote
0 likesLol
0 likesTrue
0 likesfacts
0 likeshttps://youtu.be/6HaXoi4BGwg
0 likesHe can't find them
0 likes@YRN Kells ratio
0 likesThere sold out duhhh
0 likesTrue
0 likesWell I mean would you buy a ps5 for free or pay like 1 dollar for it you would get the free one
0 likes@stinky nguyen ew Mario stop you sound like my ex wife after I cheated on her
0 likes@Ninja Dude216 whatever you say fortnite boy
0 likesBecause junior used many different copyright slogans which mr. Goodman owned. Actually listen next time
0 likesBecause it's free
0 likesJe
0 likesHe could just buy Sony.
0 likes@D1 Kellz fuck u and you’re song!
0 likesBecause the ps5 is impossible to find.
0 likesIni
0 likes😂Fr
0 likesCocky crisp
0 likesE
0 likesE
0 likesPlggy
0 likesPlggy
@YRN Kells that lowkey dookie bruh srry
0 likesf a x
0 likesB8thc
0 likesI was kidding
0 likesCam, down jamal
0 likesWtf
0 likesYour high
0 likesExactly
0 likesXD
0 likesNo he can’t he can buy trilliona
0 likes@YRN Kells ew
0 likes@YRN Kells fuck u noob
0 likesI know, that was dumb
0 likes@𝔫𝔢𝔨𝔬𝔬𝔤𝔞𝔪𝔢𝔯facs
0 likesE
0 likes@YRN Kells that shit look like the battle pass
0 likesIKR
0 likesFax
0 likesGoodman's that kind of man
0 likesBecause they were all sold out
0 likesFacts
0 likesEvery ps5 was sold out duh
0 likesBillions even
0 likesi think he didnt want to spend his money or he was really mad he wanted to take his ps5
0 likes@YRN Kells dox link
0 likesJust stop
0 likesIdk
0 likesCause hes selfish af
0 likesTrue
0 likes@YRN Kells good job
0 likes@YRN Kells nvm
0 likesBecause it’s for free
0 likesYour biggest fan
0 likes@YRN Kells that song is trash
0 likes@YRN Kells stfu
0 likes@Hoof man no bitch
0 likes@Cxmit you fuckin play roblox
0 likes@baconguynobmax you shut up bitch
0 likes@bolt_was_here you can do better?? Bitch
0 likes@YRN Kells ur song is ass
0 likes@YRN Kells you just have songs
0 likes@YRN Kells you horrible at doing videos you roblox playing person your a noob on all the games you play because your like d1 kellz mommy can you please get me robuxs please
0 likesYour mom NO YOU ARE BROKE
D1 kellz crys
@bolt_was_here bet you can’t show me a 100$ in real life bitch
0 likes@YRN Kells AND I HAVE 98 SUBS YOU HAVE 38 SEE YOUR NOT A YOUTUBE STAR
0 likesOr he can ask Richard's mom to buy one.
0 likesWhy couldn't Goodman ask Richard's mom to buy a PS5 instead?
0 likes@Tommy Gjonaj stop being so rude. That's not nice at all. We all have a heart...come on now...let's all spread some positivity..we're better than this..❤
0 likes@Cheese come on..if you don't like it you don't have to say anything and spread the negative..let's all focus on the funny vid ^^
0 likes@Carding Method you don't have to be rude...❤
0 likes@Alakazamlover4 please...spread positivity
0 likes100K subs and no verification?
0 likesLol
0 likes@YRN Kells stop doing random links loser
0 likes@Kaden Quantrille really its the fucking worst shit in the fucking world
0 likesLol
0 likeshe prob didnt want to waste the money he is like a human version of Mr.Crabs LOL
0 likes@YRN Kells that was trash
0 likessus
0 likesPp
0 likesHe did say that though
0 likes@YRN Kells y
0 likesLol
0 likesHe got it for free, and it's sold out
1 likefr
1 likeCuz he greedy
0 likesWilbur soot
0 likesyeah
0 likesI loved the song lol
0 likesHey
0 likesWell there sold out
0 likesHe said that they were sold out
0 likeshe likes saving money
0 likesHe doesn’t want anyone to have things it’s basically his stuff
0 likesWhy spend his own money on one when he could take someone else’s
0 likesa
0 likesMabye because he wants an extra and he has more I think
0 likespop
0 likesYea
0 likesWhy Is Skrumpii Speaking FAX?!
0 likesLmao
0 likesFacks
0 likes@Jettaboii he could make them produce more ps5
0 likesYES
0 likesXd
0 likesTHANKS FOR SPOILING IT FOR ME
0 likesYah i hate goodman😣
0 likesSoled out
1 likethere sold out everywhere
1 likeYeah
0 likesTrue
0 likesLast
0 likes1
0 likes2
0 likes@stinky nguyen hi
0 likesOk
0 likesTrue and I was like he literally has millions of dollars and he can buy a PS5
0 likesbc he is broke irl
0 likesdosent want to spend money
0 likesIdl
0 likesTo sell it
0 likesTo keep money
0 likesI know right
0 likes6:32 had me dying of laughter
8 likes“You can’t out cookie the crisp”😂😂😂
15 likesI love how cody yells "I'm melting!!!"
29 likesReplies (5)
No c I’m
2 likesGOD BLESS WHOEVER'S READING THIS JUST KNOW THAT GOD LOVES YOU AND HE IS WITH YOU AND HE DOES ANSWER YOUR PRAYERS ❤😇
1 like@Jake I dont believe in god <3
1 like@Grace.P🍄 honestly don’t care
1 likeSame pfp😩
0 likesOnly OGs Remember That JR Wishes That Every Food Was Cookie Crisp
1 likeSo How Did Brooklyn Guy know that the PS5 was at cody’s house if he deliverd it to jr’s house
158 likesReplies (34)
he just went to a random house.
3 likesThat's what I said how did he know the PS5 was there
1 like@emangoreee He just went to a random house
3 likesHe prolly asked jr
0 likes@Fahad Hussain Windows 7
0 likes@The_Clanker Thank you
1 like@Xx_Javier83_xX based on what? There is no info to prove that that. It was probably logan just rushing to get the video done and was to lazy to record him going to juniors and then Cody’s
2 likesit said he was going door to door
2 likesThat’s a good question
1 like@Still Lucid he was lying to convince Cody’s dad to let him in
1 likeThat’s my question
1 likeIf anybody would do me a favor and please sub to my YT? First couple subs get entered in a giveaway!
0 likesi think brooklyn t guy is a stalker
0 likesi was about to say that
1 likehe was going house to house dumbass
0 likesMe to
0 likesHe went door to door to find it if I listened to closely
0 likes#bringbacktoad
0 likesYeah that’s weird but this is sml we are talking about
0 likes@Atomic games2.0 that was a lie
1 like@Atomic games2.0 he made that up to convince Cody’s dad to let him in
1 likesubscribe to me right now why my video is going to premiere on power ranger dino fury The Official Premiere date reveal
0 likesCan’t he track his phone or the ps5
0 likes@Gugu Creane no he cant
1 like🤔
0 likesplot, lol
0 likes@fatal l and
0 likes@fatal l yes but there is an easy scene They could have done so the Brooklyn Guy went to jr’s house and jr told him cody had it
0 likesFr tho
0 likesYeah
0 likes@LoSt_Craig Yeah but They could make it make sense
0 likes@Atomic games2.0 that was a lie so he could get in to the house but How Did he even know PS5 was at cody’s house If he didn’t Ask jr Where it was
0 likesMabey he went to juniors house and junior told it was at Cody’s house
0 likesik right I sent the same comment
0 likes5:38 and that boys and girls is how the best sml song was born
43 likesReplies (2)
@The Real Slim Shitty ye
0 likes@Gorilla bro im getting a Doctor....
0 likesI love it I watched this while eating cookie crip
8 likesi just love that there is " im a apple tree from the school play " playing in the back round lol 2:42
2 likes3:18 had me laughing
3 likesLyrics:
48 likes“Cookie Crisp, Cookie Crisp”
“Ba Ba Ba Ba ba I’m Cookie Crisp
I’m Cuckoo for Cookie Crisp!,They’re magically delicious,they’re magically delicious, Silly rabbit! Cookie Crisp is for breakfast! The cereal that smiles back, they’re dangerously cheesy,you can taste the rainbow, I’m a Cookie Crisp now! Like a good neighbor, Cookie Crisp is there! Cookie Crisp gives you wings! Give me a break, give me a break of that Cookie Crisp!,finger lickin’ good!,they’re gr-r-reat!,Oh Yeah!,We have the meats,Have it your way!, Cookie Crisp you’re in good hands!, Cookie Crisp Cookie Crisp,Ba ba ba Ba ba, I’m Cookie Crisp, i’m cuckoo for Cookie Crisp, they’re magically delicious,they’re magically delicious,silly rabbit! Cookie Crisp is for breakfast!”
Replies (2)
Yes
3 likes@Professor Barranco 3 My favorite slogan is Cookie Crisp. You’re in good hands.
0 likesGod bless this channel been making my day for four yrs
6 likesI always thought the name "huggies" sounds so cute on its own lol
3 likes"Don't Give The Wolf Cereal. Give Your Children Cereal."
5 likesI love watching sml
5 likesIt’s odd that Goodman says, “I’m the CEO of Lucky Charms!” Which implies that he’s the CEO of General Mills. And General Mills owns Cookie Crisp.
283 likesReplies (35)
Bruh
6 likesWow I dont know wut 2 say i never thought that
6 likes@Duststone .
5 likesLol
4 likesHi
3 likespeople readin way too far into these dumbass jokes bro i swear
8 likesIm THE REAL CEO OF LUCKY CHARMS!!!!!
2 likes@Skylo Don lol
1 likeWow you know a lot about cereal 🥣 😏
3 likesHighly illogical....
1 likeWhat’s also odd is that his son wants a PS5 telling Brooklyn T guy to give it to him even though he can buy it or get it anytime he wants
2 likes@Jon Mcintyre oh shut up
3 likes@KEVIN AMAYA-CALDERON Also Highly Illogical
1 likeStop being smart
2 likes@Hudson 215 you’ve never watched Star Trek didn’t you?
1 likeWho liked my comment
2 likes@gabriel be nice
1 likeThat's logic
1 like@Paint Man how?
0 likesIf anybody would do me a favor and please sub to my YT? First couple subs get entered in a giveaway!
0 likesThat's slot of research. Good job
0 likesI think that is the joke but true
2 likesOKAY CODY JR ( not calling you gay, you're just very smart ;w; )
1 likeFR
2 likes@Sketty i dont need the give away but i subbed anyway because i want to spread some joy in these dark covid times
1 like@Paint Man Thank you!!
1 like@Sketty no problem 😁
1 likeHi
2 likes@Derek Eisenzimemer ?
1 likelol
1 likeWhy did you ruin the ending
1 likeLol don’t ruin it for meee
1 likeDeez Nutz
1 like@Derek Eisenzimemer r
1 likeNo the frick your not
1 likeYou may not see this but u love you your amazing keep up the great work Logan I love the whole cast you guys got the best videos u make me happy when I’m down so I love you keep the good work uo
2 likesI like how Tyrone says that he's one of them lgbtq but he also eats bacon which is pork and he's Jewish LMAO
5 likesI really don’t understand how this was a year ago! Time goes by fast 😭
8 likesReplies (2)
@DB GOAT OMG YES!!!
0 likes@Mizuchi-! ッ bruh the day that's chef pee pee quits two I remeber as soon as he uploaded i watched it
0 likesI like how Brooklyn guy somehow knew where the ps5 was even though last he saw it it was at junior's house
8 likesReplies (1)
Samessss
0 likesRemember the genie video that everything is Cookie Crisp
265 likesReplies (89)
It was 1 or 2 years ago
4 likesyep
3 likes@6IX9INE Runner we didn’t ask 😌🖐
7 likes@6IX9INE Runner we don’t care
8 likesYess
4 likesYeah
0 likesYeah
0 likesIt’s called the lamp
2 likesYes the good old days
2 likesAnd codie turned everyone gay
3 likesI do
2 likesEverything was gay and perfect like cody said
0 likesAnd 3very thing was gay
0 likesYea
0 likesYa
0 likesYes
0 likesWas that called the lamp 🪔
0 likesCopied
0 likesYes
0 likes@6IX9INE Runner liar
0 likesI do that one was funny😂😂
0 likesI remember cody wished to make everyone gay
0 likes@fłîpfłïp ya like who forgot it?
0 likes@fłîpfłïp yea i also remember in that vid everyone was gay
0 likesI remember
0 likesI remember every SML
0 likesWho doesn’t
0 likesYes
0 likesYes becauses it wasn't that long ago
0 likesYe i rember i was thinking bout it rn
0 likesLol I remember that
0 likes@DatFurry Boi I said that alwready
0 likes@julien marrero I said that already
0 likesbruh this video has a lot of commercial jingles
1 likeand yes it’s called the lamp 🪔
@_little.shortyyy the one time im okay with someone saying didn't ask
0 likes@6IX9INE Runner and I'm Logan paul
0 likes@Starious I already said that omg
0 likesThat was a good one
0 likes@Coolprodude6277 I said that already
0 likesYE
0 likesHehe...
0 likesHello everyone! I'm sorry for Self Promoting but I'm fixing to have Surgery and it would be nice if you all helped me hit 10k 😊
1 likeYeah
1 like@Nate👽 stfu it was 2 or 3 not 1 or 2
1 likeYep
1 like@RST Street Bmx SML idea: Toad’s family
0 likesI thought this was a video of that
0 likesYou made me
0 likesYes
0 likesI do it’s gay
1 likeyep
0 likesIkr
0 likes@Doges Awesome ya cause it new
0 likes@6IX9INE Runner stfu
0 likesYup
0 likesYa
0 likes@6IX9INE Runner please shut up...
1 like@Kenny Mc I like this idea
0 likesDefinitely can't forget that video. My lord, junior has the IQ of 5
0 likesYea I loved that video
0 likeshttps://youtu.be/l_2Z7iqdqtI
0 likesikr https://www.youtube.com/watch?v=iWfOTbaufqQ
0 likes@6IX9ONE RUNNER nobody likes a snitch
0 likeshttps://youtu.be/l_2Z7iqdqtI
0 likes@Lisa BW17 do you really have to put a jake Paul video
0 likeshttps://youtu.be/l_2Z7iqdqtI !!
0 likes@Lisa BW17 bro
0 likeshttps://youtu.be/l_2Z7iqdqtI !!!!
0 likeshttps://youtu.be/l_2Z7iqdqtI !!!!!!!
0 likes@6IX9INE Runner cap
0 likes@6IX9INE Runner Can you like not fake somebody
0 likes@UCV7C6BY0I0lyAbxUb45UE1A LMAOOOOO
0 likes@KarateGirl08 I don't look at the comments that's why I said it
0 likesYep
0 likesYea
0 likes@DatFurry Boi okay
0 likesYes
0 likes@DanTDM fan GamingRich mk
0 likes@6IX9INE Runner we don't care
0 likesCOOKIE CRISP 😫
0 likesI do
0 likes@BoppedByIso that would be like 2017 and older
0 likes@Nate👽 I what ewas re why
0 likesoops caps lock
0 likesIkr
0 likesAh memory's
0 likesThat genie episode was a god damn classic, no contest, no comments.
0 likes911
0 likes,177
0 likesI learned more from this video then the past 2 years of school
2 likesI remember eating this as a kid lol
19 likesReplies (6)
Are you a kid
2 likesNo one cares there was nothing funny and u said lol
0 likesAko si glamrock chicka gregory were are you hu wants candy
0 likesI never eat a cereal
0 likesBut i wanna eat a cereal
0 likes@Edwina Gabanes wtf
0 likesIt’s sad how the newer generations will never know how good these videos were, Jeffy cursing every second, the pillow fort, Cody’s saga over ken (broken, taken etc). Junior and Cody being locked in a pantry, the toilet burger that made bowser a zombie, chef Peepee the robot
122 likesReplies (37)
I'm from the generation when they had 100k subs
4 likesI’m from the gen when they had 1k
1 like@Minecrystal sure you are
4 likesYeah I remember watching sml before Logan even hit puberty soooo
3 likesi started watching in like 2019 but i still enjoy the older vids
2 likesRemember when logan had a bowl cut?
8 likesHi
1 likeYEAH IT IS
1 likeI miss them vids to
1 likeYa your right I was here from the beginning and I can see every change
1 likeive been watching sml since they had 1 million subs on the og channel but i probably am not og
1 likeI am from the generation when they where SuperBowserLogan.
1 likeI am from the generation when they where SuperBowserLogan.
1 like@Minecrystal ur acount was made i 2022 lol
2 likesDoes anyone notice that cody tree song music was playing in the background when the commercial was playing
2 likesThere's a channel that has the old sml videos with the plushies called SML Reuploaded
2 likesI remember all of what you just said
1 like@xurects Originally watched during the summer school series and stuck around through to today. It was a funnier time back then.
1 like@awake i watched maily since they did Luigi
2 likesIve been watching since 2017 and I love all of his videos. My favorite is the wish burger.
1 like@xurects Oh the Mama Luigi era, such simpler times. I did watch some of them when they were still available on the main channel, but not as frequent as Junior. Never really liked Jeffy tho lol
2 likesBro those videos were legendary
1 like.
1 likeI was the second subscriber
1 likeThats cool
1 likeI miss the old days
0 likes100 like made song SML
0 likesWe miss the old days, but they could stop any day.
0 likesor like home alone
1 like@xurects Ayy same
0 likes@Kronicleツ omg that shit was hysterical
0 likesBro said generation 💀
0 likesYeah those are only OG moments
0 likes@Jammygamer 123 called alts duh
0 likes@johnplayz u aren't your channel was made in 2021
0 likeswell SML re uploads might upload
0 likesStarted watching SML back on the sIGNED OUT PAGE, STARTING IN 2014 TO 2022. Miss the old videos
0 likesSml back with the best quality
13 likesI literally laughed so hard when I heard the Cookie Crisp song! 😂😂😂
63 likesReplies (10)
i didint
2 likesDude same XD
1 likeI like it
2 likes@Yoshme when the part they said of McDonald’s slogan I literally started laughing especially when Cody is telling them to stop but they ignored him XD
0 likesSame lmao
1 likeI was laughing so hard my face got sore.
1 likeBu bu bu bu bu I’m cookie crisp
1 like@Gugu Creane I’m coo coo for Cookie Crisp, they’re magically delicious, they’re magically delicious, Silly rabbit! Cookie Crisp is for breakfast!
0 likesMe Too Laugh Died
1 likeBruh how is it funny
0 likes12:26 AHHHH IT'S THE COPS! slams door
10 likes4:12 I like when junior was like foot long sounds like something you like and when Joseph said right dude was so funny to me (also I love SML it’s actually my Initials lol.
0 likesI was eating Cookie Crisp while watching this
3 likesI love how kazoom was quietly playing in the first ad
10 likesReplies (1)
bro i like didnt notice that heres the timestamp 2:42
0 likesSML's playing it real risky after nearly being sued by Nintendo.
0 likesIt feels so good to watch sml again I haven’t watched it in years
20 likesReplies (6)
no cap
1 likeSame
1 likeI really like your videos but you have five times but Ashley I like your videos super much in Ashley my name is Parker yes sir lol really like your videos in Ashley was your name
1 likeOh yes oh yeah and sorry I messed up my words so please don’t read that and actually my name is Parker in with your name
1 likeSame
0 likesSame
0 likesI love how the background music in the commercial is I am a apple tree song
0 likes2:20 me when my mom bought me the toy i wanted
0 likes7:14 Had me dying so much 🤣🤣🤣🤣
85 likesReplies (7)
It is me not my
0 likes@58 years ago hi
0 likesPa pa pa
1 like@58 years ago hey
0 likesMe to
0 likes@58 years ago he just had a tipo
0 likes@58 years ago sorry autocorrect
0 likesThe beginning of the video of pp makes it look like that he actually cares about Junior
0 likesI love Cookie Crisp it is just so delicious like it is so GOOD
0 likesMy favorite cereal is cookie crisps I’m buying it right now
0 likesi loved sml for a long time !!!!!!!!!
0 likeslol at 6:43 that was my fav part when cody got confused and then he realized lol
1 likeReplies (1)
This is a long time ago
0 likesMAGICALLY DELICIOUS! 🍪🐺
2 likesReplies (1)
that's lucky charms
0 likesShould we just all appreciate Cody for naming all the fast foods and others
20 likesReplies (6)
Yeah
0 likesState farm
2 likesE
1 likeYes we should
0 likesCuckoo for Cookie crush the magic wizard cookies give me a break give me a break of that cookies good they're great oh yeah they have the meat because you're good bubble bubble I'm cooking Chris
0 likesI'm cuckoo for Cookie crisp. the magically delicious. cookie crisps gives you wings. give me a break give me a break of Cookie crisp. finger licking good they're great. oh yeah they have their meats. Cookie crisp you're in good hands. Cookie crisp cookie Crisp bubba bubba bubba I'm cookie crisp.
0 likesI love it
1 likeVideo Idea: Brooklyn T Guy's Divorce
44 likesSimilar to A Day In Brooklyn T Guy's Life, Brooklyn Guy divorces Karen from getting to annoyed to the point he loses it.
Replies (2)
Thank you that I was thinking
1 likenoice
0 likesI Like This 😂😂😂
0 likes7:22 had me dying the way cody was explaining that they were gonna get in trouble and stops everything to be like mm no that’s coco puffs😂🤣
5 likesReplies (1)
12:26
0 likes2:20 got me laughing like crazy
4 likes2:20 is my favorite part
0 likesWhy is nobody mentioning the disposal threat Cody's mom made😂
30 likesI love Cookie Crisp!
0 likesIts so funny when Joseph says Cooookie Crisp!
0 likesI have a question for a end of a video "What was your favorite childhood show?"
0 likesMy favorite cereal is actually cookie crisps lol THEY ARE BASICALLY COOKIES WITH MILK AND ITS SO DIVINE
4 likesReplies (1)
You must be a little kid
0 likes5:36 this will be known as the sml finale song.
39 likesReplies (1)
Hahahaha
1 likeThis video is very funny I love this one so much!!!!!!!!!!!!!!!!!
0 likes16:47 this scene looks like from the game its kinda Like a king walking to hallway u have to Smack him with any Heavy Equipment I forgot the name lol
1 likedid anyone notice the song playing in brooklyn guys ad was the music from cody's "I'm an apple tree" song?
2 likesReplies (1)
Yea I did but I thought I was the only one
1 likeI wish the second half of this video was about Junior being sued by those companies he pissed off..
0 likesI’m eating cookie crips rn🤣
0 likesJoeseph said “it didn’t come to me in a dream!” 10 seconds later he says “it just came to me in a dream!”
0 likes3:37 this song actually hits different
0 likes2:20 Joseph: Cooookie Crisp!!!!! (*Slams his Head on the Bowl*)
0 likesI remember when I was little I just found a box of cookie crisp at the store (I’m British as well) and they used to have a different box I think a while ago, and I loved it
53 likesReplies (7)
Yep, just as I thought, kids commenting a load of bullshit, nothing new in this day and age
2 likes@Apple SheepPlays! Cut them some slack, they put their heart into writing that.
2 likes@Naturic I can try i guess
1 likeAdd a public reply
1 like@NotBlade I think they was talking about that person saying random letters or something
0 likes@Jaquan Kelly what?
0 likesUK cookie crisp are the same just branded by kellogs
0 likesOnly the OG’s know dad Junior wish that all foods was cookie crisp
0 likesThat’s so funny too funny too funny 😂
0 likes5:20 laughing part
2 likes16:54 is my favorite part
0 likesSML idea: Bowser the actor
198 likesBowser goes to an audition for a role of extra in Charleyyy and friends, and he gets it. But his fan side makes him get into very funny situations
Please like so Logan can see it
Replies (10)
Thats actually would be a good idea
5 likesCharlie basically plays Joseph
3 likesO
0 likesThat would be a great video
0 likesI Agree .Great Video Idea!!!!!😱
0 likesYes plz
0 likesLogan doesnt look at the comments so it wont be a Video.
1 likeHe said it one time but I dont remember
Gg
0 likesIts a great idea but heres the thing charleyyy and bowser are the same voice actors
0 likes@ovan elliott Jesus loves you
0 likesI love how they were supposed to make a slogan but made a song
0 likeswait, those vegetables looked kinda good though
0 likesAmazing video sml I love yours videos
0 likesThis is one of my fav episodes of sml
7 likesThis reminds me when junior turned everything into cookci krisp with his wish
284 likesReplies (64)
If anybody would do me a favor and please sub to my YT? First couple subs get entered in a giveaway!
2 likes@Sketty stfu
18 likes*every food
1 likeYeah
0 likesYou spelled cookie wrong
3 likesThat brings me back
0 likesExactly
0 likesSame
0 likes@Project zorgo Leader Chad vy regena and danial will take you down
0 likesMe too
0 likesTrue
0 likes@Victor Teets you know that it’s scripted right?
0 likes@Rayd0n I know
0 likes@Sketty ew self promo 🤮
0 likes@Average Messenger I’ve gained 40 subs from it soooo
0 likes@Sketty fuck you
0 likesOmg I remmeber that
0 likesLmao looser!!
0 likesSame
0 likes@Sketty no❤
0 likesOhhh yeaash
0 likesOmg yes
0 likesSame
0 likes@Sketty did it
0 likes@Victor Teets YES THEY WILL SPY NINGAS 4 LIFE!
0 likesWait weren't you on pokes roblox vid
0 likes@Victor Teets they did
0 likes@souleater556 aren't you in flamingos roblox video when you blocked him you gave him advice or are you just a random person
0 likesYea same lol
0 likes@Sketty nobody cares
0 likesYep
0 likesYa
0 likes@Sketty no one cares
0 likesFr
0 likes@Ayden Willis cool 👍😎
0 likes@F34R Uzi cool 😎👍🤌
1 like@SuperShadowJared you shut up
0 likes@Catherine Ferreira dont be mean or else it will be karma :) lol
0 likesIkr
0 likes@Sketty ok :D
0 likesU spelled it wrong i can see from ur profile picture adopt me really? Stfu
0 likes@Rayd0n niggaaaa
0 likesIKRR
0 likes@Sketty I’ll join
0 likesYea
0 likesYes
0 likesDo Not Eat Cookie Crisp Because There Unhealthy! So Start Eating Healthier
3 likesEw Poor
2 likesInit
0 likesDon't Say That
2 likesStop
2 likesOk Stop
1 likeSAMEEE
0 likesENOUGH IS ENOUGH STOP
0 likesTrue
0 likes@SuperShadowJared true
0 likesCan you spell
0 likes*cookci krisp*
0 likesI almost died after saying that! XDDD
@0syll same🤣🤣🤣🤣🤣
0 likes@Sketty you annoying AF
0 likesFacts
0 likesOgs remember that
0 likes@Sketty but u don’t have any content
0 likes@G_man shorts used to. I gave up
0 likesWhen the coin landed on its side I was hopping Cody would say "there is a god".
0 likesI love your vids
0 likesWho would of guessed playing with dolls will make you millions 🔥🔥
0 likesI like when Joseph say OMG IS THAT VEGETABLES🤣🤣🤣 0:56
0 likes"Do you want diabetes"
325 likes"Yes"
Never could of thought it another way.
Replies (17)
Lol
4 likesWhat no u don’t Junior shut up
6 likes@Medjino Jacsaint Rick roll?
3 likes@Fox Interacarlton Television Distribution ?
3 likes@Medjino Jacsaint fgdyf
1 likeBrandon
1 likeF
1 like@Omnious Butter 3:>
1 like@Buniboi no some random person channel
1 like😂
1 like@magneetis yeetis gaming what YouTube name was that
0 likes@Elliot Pelenc ? Wdym
0 likes@magneetis yeetis gaming it's a long name for that channel
0 likesP:>
0 likessubscribe to me right now why my video is going to premiere on power ranger dino fury The Official Premiere date reveal
0 likesGayyy
0 likes300th like
0 likes“Silly rabbit, Cookie Crisp is for breakfeast!”
0 likesProceeds to collapse and gain amnesia
16:34 to 17:20
0 likesAnyone notice that it was a game reference from an indie game where you walk behind the king with a weapon and try to kill him without being caught?
Lol I’ve been watching jeffy since I was 7.now I’m 15
0 likes3:48
1 likeJoseph: 5 Dollar, 5 dollar Cookie Crisps!
This video is legendary to me🔥💯
16 likesReplies (1)
Smfaxs
0 likesI loved when Joseph and Cody said “Cookie Crisp Time”
7 likesReplies (3)
chicken dinner nugget for lunch and a salad 🥗 with bacon
0 likes@banana socks 🤢🤢🤢🤮🤮🤮🤢🤢🤢🤮🤮🤮
0 likesyum salad
0 likesI love all your videos
0 likesYou’re my favorite YouTube 🤣🤣🤣
0 likesIf I were to come up with a slogan for Cookie Crisp it would be “Cookies meant for the A.M”
0 likes2:20 me when I eat a bowl of candy for breakfast
43 likesKaren is my new favorite character after watching this
0 likesJunior: alright guys I got the cookie crisp
0 likesCody:that’s what I’m talking about
Joseph:COOKEI CRISP “slams head on cookie crisps”
COOKIE CRIPS I LOVE THEMMMMMMM
1 like0:57 that's Joseph's worst victim
1 like14:38 he could’ve said he knows where he lives cause he babysat his pets
30 likesReplies (4)
Yea Logan doesn't follow the story sometimes
1 like@Rogue1323x_x lol what story its his so he can change it if he wants
0 likes@SegsyCrocs He just gets videos not compatible with the storyline
1 like@Rogue1323x_x are you part of the people who said the creators of uno don't make the rules just the cards
0 likesMy favorite cereal is fruity Pebbles❤️
0 likes8:45 best part
0 likesRalph wished for an adult to come and save them, he wishes for a message from grown ups
0 likes7:28 best part
0 likesMy favorite part was “silly rabbit cookie crisp is for breakfast”
29 likesOnly og’s remember when Goodman wore a blue suit and was the cop
0 likesI really love this song
0 likesI watched this while eating Cookie Crisp
0 likesWhen the guy was talking for the cookie crisp I hear the new song from the other sml channel. If you can hear it, then you heard the future
0 likes2:20 Joseph: Cooookie Crisp!!!!! (*Slams his Head on the Bowl*)
18 likesI’m eating cookie crisp while watching this
0 likesWho forgot about cookie crisps until now 😞
0 likesOnly Sml gods will know
1 likeI remember when junior wished every food to just be cookie crisp
1 likeReplies (1)
same i still miss that video
0 likesWhen junior says “cookie crisp your in good hands” I heard Cody say I’ll say the first time instead of Allstate but honestly it sounds just as good
30 likesReplies (1)
Hi
0 likesMaybe Cody aint such a nerd 😂 1:37
0 likesChef pee peeps food makes my mouth WATER 🤤🤤
0 likesWhen jr sang it was really funny
0 likesFun Fact:Junior did 49.50%(singing) of the work,Joseph did 49.50%(lyrics) of the work,and Cody only did 1%(recording) of the work.
1 likeReplies (1)
E
0 likes6:15 this part is funny with all the commercial brands flipped around with Cookie Crisp 😂
16 likesBrooklyn guy: *hits jr with a hammer*
0 likesJr: *D I E S*
I love your videos
1 likeBrooklyn guy : make a slogan
0 likesJunior : makes a song
Brooklyn guy: perfect
How did Brooklyn guy know which house to go to and somehow knew to go to Cody’s house🏠
0 likes"joseph" "heh i called you joseph"
47 likesfor some reason thats funny for me
17:58 aren't you also the CEO of cookie crisp because you're the CEO of Lucky charms and lucky charms is owned by general mills, general mills also owns cookie crisp so that makes you the CEO of cookie crisp
0 likesI like how the police man gave the PS5 at Jr house and police said I know where it is I gave it to them and he KNEW EVERYTHING THAT HAPPENED HE KNEW THAT CODY TOOK THE PS5
0 likesHow did the cop knew it was at Cody’s house when he dropped it off at juniors house?
0 likesWhen I saw this I have to get some cookie crisps
1 likeNow I can’t get that damn Cookie Crips song outa my head.
35 likesReplies (1)
Same
2 likesCookie crisp looks delicious
0 likesi like your vids^-^
0 likesThe reason I like Cody is because he actually thinks -
0 likesHe can’t sue because Cody basically gave credit to the companies after Junior sang their slogan
2 likesReplies (1)
Smort
0 likesWhat ever happened to Principle Steinbeck?
75 likeseh, he probably got arrested.
Replies (11)
Yup
2 likeshttps://youtu.be/aNOI2v5izN8
0 likes@ToothpasteAssassin reported him
1 likeI thought the same thing too
0 likes@ToothpasteAssassin self reporter?
0 likeshttps://www.youtube.com/channel/UCCWXO9zJSjhJvUzCwAeeSlg/featured
1 like@ToothpasteAssassin did u just say self reporter lmfao
0 likeshttps://www.youtube.com/watch?v=dvJgbYUQt-c
0 likes@ToothpasteAssassin self promoting isnt a bad thing, if ur tryna get people to report this dude, u got about a billion left
0 likesYeah
0 likesyup
0 likesI actually thought those vegetables are kind of good
0 likes2:20 Joseph needs medical attention lol
0 likesBest advertisement for Cookie Crisp
0 likesi ate cookie crip while watching this 💀
0 likesVideo ideas:
32 likesMario’s Parents!
The Fight!
A day in the life with Jeffy!
A day in the life with Joseph!
Replies (10)
The
2 likesIt’s 1 year and Jan 1 or 31 ago
1 likeThere already a video call junior mom
2 likes@friel plush bro duhh there’s already one after his reply cause they accepted
1 like@friel plush bro and the fight
1 likethis guy is tryna act cool and pretend he guessed everyone
3 likeslike he edited it LOL
0 likes@vXpoLion Me?!
0 likesWhat about "Jeffy Bezos" ?
1 likeWhat's your video name
0 likesI love how Cody knows every simple like Pizza Hut cookie crisp
18 likesLove this channel
1 likeReplies (1)
Bro
0 likesSML is the only one that changes my life
0 likes2:43 you can hear the music from the SML Movie: 3 little pigs!
2 likesReplies (1)
I can hear it
0 likesHere’s a custom one
29 likesBowser Junior: In The Name Of Cookie Chrisps, Ill Punish You!
Cody: What? That’s Sailor Moon!
if Brooklyn deliver the PS5 at junior house how did he know that the PS5 would be at Cody house
1 likeAny one else hear when Brooklyn guy is on the tv you can hear Cody’s kazoo solo
0 likesBro I just thought about this the background of the commercial with Brooklyn guy the song has the apple from the play 😂😂😂😂
0 likesCookie crisp are my favourite cereal!
1 likeReplies (1)
Aren’t they
0 likes2:20 Joseph: "COOKIE CRISP!!!!"
18 likesReplies (2)
5:37
3 likesminigun sound
0 likesthats great put this for every intro if you have one
0 likesThat bowl of veggies looks delicious.
0 likesI love Cookie Crisp because of this video
0 likesWithin the assembly, many people were repeatedly interrupting the others who were talking without having the conch. Throughout the assembly, Jack talked over many people without the conch in his possession. He continually kept breaking the one firm rule they had.
0 likesI like “out cookie the crisp” lol
54 likes(*edit*) thanks for the likes
Replies (4)
Lol
0 likesLol
0 likesLol
0 likeslol
0 likesTo this day im still wondering how tf brooklyn guy knew the ps5 was at codys when they were all at junior's when he gave them the console, it bothers me so much someone please have an explanation cause i think logan made a mistake when making this video
0 likesEasy fix to the first problem: One of them plays it for the first four month, another one of them for the other 4, and another for the last 4
1 like0:44 so funny
0 likeslol junior could just take the cookie crisp slowly instead of throwing the vegetables at chef pee pee's face lol.
1 likeI love how you didn’t retake the part where you called Cody Joseph XD
67 likesReplies (7)
xddd
1 likey do u love someone being lazy
0 likesWhere
2 likesHi
1 like@Ray Ray 5:21 my dude there
3 likes@Mistamack713 hi
1 likehttps://youtu.be/oZFAXdTMeXM
0 likesMy idea for a slogan
0 likes"A sweet taste to start the morning"
I love your work ❤ 💗
1 like6:34 best part
1 likeReplies (1)
Sheetos…
0 likesI like how do Junior said bull's-eye
0 likesAlternate title: Junior learns about copyright
254 likesReplies (24)
https://youtu.be/eRJ5ihFvAqE
1 like@Hiretothgether mshohoho yeah this guy is a self promoter don’t dislike the video just report
2 likes@Hiretothgether mshohoho here’s a message..... 🎵 Stop promoting your own channel in the comments dude it doesn’t work just bad Business when you see someone promoting their own channel in the comments just mark it as spam cause thats Exactly what it is🎵
3 likes99% of y’all won’t see this but I hope you’re having a great day🥰
2 likesI’m a small content creator & make videos & it’s my dream goal to get to 2k of yt friends for my birthday in February❤️
That’d mean alot to me if you can check my channel out☺️❤️
https://youtu.be/O77XlKNsgEI
1 likehttps://youtu.be/O77XlKNsgEI
1 likeAlternate title : the copyrighted song
1 like@Hiretothgether mshohoho idc
1 likeIf anybody would do me a favor and please sub to my YT? First couple subs get entered in a giveaway!
1 like@Sketty I subbed
1 like@ZaxZyte bro you should actually make a song of this lmao
1 like@Bluey it’s an actual song it’s called a message to all commenters but I wished that I the idea first
1 like@Hiretothgether mshohoho I don't like it
0 likeshttps://www.youtube.com/channel/UCCWXO9zJSjhJvUzCwAeeSlg/featured
0 likessubscribe to me right now why my video is going to premiere on power ranger dino fury The Official Premiere date reveal
0 likesOh yeah that’s right
0 likes@ZaxZyte oh yeah that’s right he cares about himself
0 likes@GamersForceRevice785 pls stop
0 likesHey dragon ball super profile nice one
0 likesAlternate title: Goodman sues Cookie Crisp
0 likes@Sketty no earn ur subs fam
0 likesyou’re serious getting subs this way is a poor strategy you’re always going to get reported and then get told shut the fuck up 🤦♂️
0 likesEdit: do you wanna know something if you get reported and banned by the creators people won’t be able to see your comments anymore
@ZaxZyte xD good one
1 likeWow really
0 likesimagine this after all of their ads
0 likes13:00-13:51 is halarious
0 likesJunior actually love cookie Chrisp
0 likes4:14 Why was that so funny 😂
4 likesReplies (2)
found you again
1 like@Spirit Halloween Hangout indeed
0 likes“What is your favorite cereal?”
25 likes1. Froot Loops
2. Cocoa Puffs
3. Trix
4. Honey Combs
5. Applejacks
Replies (4)
ooooooooooooooooooooooooo Mine r
2 likes1.Trix
2.Lucky Charms
3.Peeps Cereal
and lastly a cereal that i call Purple Cereal
Prob more that i cant remember atm ( i dont know why i shared this )
Nah
3 likes1. Reece’s puffs
2. Froot Loops
3. Cocoa Puffs
4. Cinnamon Toast Crunch
5. Honey bunches of oats
TRIX
0 likesMine is Trix and Applejacks
0 likesThis is so funny
0 likes8:08 I'm Cookie Crisp
12 likes18:22 I'm Sewer It
18:11 that's inaccurate. they own trix and cocoa puffs.
1 likeI don’t understand this but its beautiful.
0 likesThis reminds me of “The Lamp” video the one where Junior wished every food was Cookie Crisp
69 likesReplies (12)
Hello everyone! I'm sorry for Self Promoting but I'm fixing to have Surgery and it would be nice if you all helped me hit 10k 🙂
2 likesSame
1 likeFacts
0 likesSame
0 likesSame
0 likes@IanKava even if u are faking respect to u I subbed
0 likesIt does remind me of the lamp
0 likes@The manga nerd How is taking advantage of people by faking a surgery respectful? Just tell him to stfu like he should
0 likesSame
0 likes@Waste Of The Ocean same idk why someone would worry about subs if they need surgery
0 likes@IanKava Subscribers dont help with surgery.
0 likesYes because it deals with Cookie Crisp
0 likesNow that was a hilarious video!😄😃😀🤣😅☺😂
13 likesI have the same ukulele that Brooklyn guy’s wife has
0 likesI wonder what this all will look like if Cody agreed will Junior
1 likebut these vids make me laugh
Did anyone else hear junior say “if colors can get arong” sounds like something Jackie chuu would say😹
0 likes5:33 someone make this a concert ill be there
0 likesAnyone else hear Im an apple tree durning Brooklyn Guys camercial? I thought I figured something cool out lol.
0 likesWho watched the song over because how good it was?
0 likes0:15 I wonder how they recorded that loud groan 🤨
0 likesI like how they didn’t cut out the part when junior called Cody Joseph
55 likesReplies (9)
lets see how many people would subscribe to me after seeing this comment Current--(207) You can help raise that number by subscribing to my channel
4 likes@MrMajestic hopefully 0
6 likesWoosh
1 likeWe can get fat if we want to !!
3 likesIt made it more realistic like in real life when you call your friend a different name by accident
2 likes@MrMajestic shut the fuckkkk up
1 likeWhatpart
1 like@MrMajestic nobody gives a fuck about your channel.
1 likeSorry a bot copied your comment
0 likesDuring the news if you listen closely you can hear I'm an apple tree from the three little pigs from SML
1 likeI love this song
0 likesAlternate title : SML gets sued before the 2022 lawsuite!
0 likesI wanted to be like you'll one day.
0 likes"Cookie crisps with some coca cola"
16 likesThis video shows that there’s so many companies with different slogans it’s so hard to make one
0 likesLogan can you please make Jeffy‘s favorite vegetable I think it would be a good idea
0 likeshow did brooklyn guy know to go to cody's house when he gave it to them a juniors house
0 likesHappy 1 year birthday 🎉
0 likesJoseph is so cute 😍😍
0 likesGood bless you and your family💚
0 likesReplies (1)
You mean god bless you and your family
0 likesAnyone else noticed that Joseph was a Paratroopa and not a regular Koopa Troopa?
0 likesI love this music video
0 likes2:20 me when I have candy for breakfast plus having cookie crisp
13 likesJeffy 💗💜🖤💙💛💚🧡❤️♥️
1 likeprops to cody finding all the references in the song
0 likesReplies (1)
haha
0 likesHow'd Brooklyn t guy know that the ps5 was in Cody's house?
0 likesHow did bruklin guy know it was at Cody’s
2 likesReplies (1)
learn to spell🤣🤣🤣🤣
0 likes“Oh ya put it in my bowl daddy”
108 likesReplies (24)
Wtf this is the wrong video 😳
2 likes@TTotal mania alot
2 likesohh yess someone says this to day and im POURING that Cereal in her god damn bad naughty bowl of milk! xD
2 likes@Daniel Arandia UHMMMMMMMMMM
2 likesLet's see how much subs I can get from this comment
3 likesAim 100
Current 5
@Jasmine Lara Uhhh uh. Some are here for the lulz. I’m here for the UUUHHHHZZZZ
0 likesMy goal is 444556655443m
0 likes@Chad wild clay my goal is getting 1 sub from you 😃
1 likeUmmm wrong video...
1 like@Qwerty Is quirky y’all are getting no subs and y’all are gonna like it!
0 likes@Daniel Arandia I sure will
0 likesWhen Joseph said Cookie
1 likeCrisp so creepy I was just laughing when you was pounding it
@Monkegod123 if she’s laughing while you’re pounding it then that’s probably not a good thing at all 😂
0 likesOh ya put it in my cup daddy
0 likes@hdz put it in the same cup the 2 girls 1 cup girls used....
0 likes@hdz lol
0 likes@Daniel Arandia wtf
0 likes@200 Xixxy . old but gold, it was the wtf of my day too back in the older internet days
0 likesIma put in your bowl first give me 20 bucks
2 likes@The crafted God ok
1 like@Daniel Arandia im a fucking boy
0 likes@Victorio and? Why’d you feel the need to disclose that?
1 like@Daniel Arandia I had to
1 like👌 👍 lol pog ✅
1 likeAnyone notice Joseph said sometimes I keep my tv on that shows he's rich
0 likesMy brother uses that song when he gets a call so when I hear I just think he has a call
0 likesThis really got sml sued and made them rebrand lol
0 likes2:45 to 3:15 you could here the audio from Cody's apple tree song
0 likesVideo suggestion: Jeffy's sleep paralysis or juniors either works
11 likesReplies (3)
Yas boi
0 likesYes that would be AWESOME
0 likeshttps://www.youtube.com/channel/UCCWXO9zJSjhJvUzCwAeeSlg/featured
0 likessuch a banger 6:04-7:33
0 likesi love cookie crisp
0 likesand i love sml
If you remember the genie video where everything was cookie crisps then your cool 😎 no I’m not a bot* 👴🏻
1 likeI miss the old cookie crisp mascot.
0 likesI think they’re sponsoring cookie crisp
32 likesWithout us even knowing
Replies (2)
oh my god!!!
1 likeYes sir
0 likesAnd I really like the junior ones
0 likesIm watching this while eating cookie crisp
0 likes6:40 I wonder how much copyright claims there gonna get
0 likesIt's funny how most of the video is about a stolen PS5 than COOOOOOOKIEEE CRISP!
0 likes“junior do you want diabetes?” “Yes” “WAIT WHAT”
44 likesReplies (9)
Both:COOKIE KRISP TIME
0 likesalso both:EWW VEGABLES
that is a funny joke though
0 likes@Harvey Gibson no it was a bland joke
1 likeI remember in the magic lamp video, Junior made a wish that all the food in the world to be cookie crisps and a lot of people were dying and getting diabetes because of only eating cookie crisps
0 likeshttps://youtu.be/O77XlKNsgEI
0 likes@MajinChris depends on your taste
0 likesAnd I spelled crisp with a k for some reason
0 likesIf you like a joke not everyone Is going to like it
0 likesp
0 likesCoffee systematically delicious
1 like;( back then life just hit different
0 likeshow did guy know where the ps5 was he delvered it to jr's house and knew it was at Cody's house
0 likes4:00 I’m laughing
1 likeSML IDEA : Bowser Jr and his friends get rich so Richard actually likes it
8 likesReplies (2)
I like your 💡
0 likesThanks
0 likesI was eating cookies when i was watching this
0 likesThose veggies actually look really good
1 likeReplies (1)
@SuperNintendoVideos yeah🤣
0 likesanyone notice that the song playing in the background of the cookie crisp commercial is cody’s apple tree song
0 likesTHIS GOOODD I Listen to it 40
0 likes“You talk back to me one more time and I’m gonna turn the disposal on”
21 likesDidn’t Junior already have a ps5? That’s in the candy salesman video.
0 likesSpeaking of cookie crisps I own a box
1 likeI’m a Cookie Crisp now
1 likeThe implication was that the boys should be afraid of one another because the only danger they faced was from other guys. Each boy was distinct and had various variances among himself. The boys' lives became more difficult as a result of this personality conflict and the lack of an authority figure. Fights and arguments continue to erupt, and they are becoming increasingly violent. The guys have already decided not to follow Ralph's directives or rules, despite the fact that he has been designated as their leader.
0 likesI was dying when he was singing the song
18 likes3:17 joseph eat cookie Crisp like a woodpecker
0 likesI love your video.
0 likes6:37 i think that’s Starburst not skittles
0 likes0:17 That’s the noise I make when I see your IQ Score
1 likeI was dying how Junior was taking everyone slogan and Cody naming the people who did it
23 likesReplies (4)
Omg same
0 likestrue true
0 likessubscribe to me right now why my video is going to premiere on power ranger dino fury The Official Premiere date reveal
0 likesTrue
0 likesHow did Brooklyn guy know where Cody lives and how did Junior know where Brooklyn guy lives🤔
0 likesThe scene with Brooklyn guy following junior reminds me of the murder be the king games
0 likesIf you listen closely you can hear the cody kazoo solo in the advertisement
0 likesIt’s funny how Brooklyn guy is supposed to stop crimes and he just did a crime lol
0 likesImaging Stealing then saying "don't steal" XD
10 likesReplies (2)
Then too late you already did?
1 likeThen that’s illegal
0 likes2:20 Joseph being Joseph
0 likesFun Fact:You can hear the song from the three little pigs video in this vid
1 likeWords by jr "if colors can get awong then they can get along"
0 likesCan you make more parts of play time series please
0 likesI love how Junior cody and Joseph haven't probably ate cookie crisps in a long time😂😂😂
21 likesMe eating cookie crisp RN lol
0 likesNot gonna lie the Vegetables look delicious
0 likes5:37 song starts
1 likeWhat would you do if mr Goodman showed up at your door and forced you to let him inside your house?
0 likes5:37 this crap is literal 🔥
26 likesReplies (3)
Top 5 sml songs
0 likesTop 5 sml songs
1 likeEninem is scared rn
0 likesI loved this cereal but the fifth time I ate it I had a stomachache and stopped eating it
0 likesI love this jr funny
0 likesMe and my sisters favorites are Froot Loops and Cinnamon Toast Crunch
0 likesit's 2022 now and I remember when I first watched this good memories
2 likes2:43 perfect timing ad
11 likesLyrics:
1 likeA and B: "Cookie Crisp Cookie Crisp
A: Ba Ba Ba Ba Ba I'm Cookie Crisp.
B: Wait that's McDonald's.
A: I'm coo coo for Cookie Crisp,
B: That's Coco puffs
A: They're Magically Delicious,
B: T-That's Luck charms,
A: they're Magically Delicious,
B: what?
A: Silly rabbit, Cookie Crisp is for breakfast.
B: Ok that was Trix.
A: The cereal that smiles Back,
B: Goldfish.
A: they're Dangerously Cheesy,
B: Cheetos.
A: You can taste the rainbow,
B: that's Skittles.
A: I'm a Cookie Crisp Now.
B: H-HUGGIES!?
A: Like a good neighbor,
B: what?
A: Cookie Crisp is there,
B: State farm?
A: Cookie Crisp Gives you wings,
B: Red bull?
A: Give me a break,
B: what?
A: Give me a break of that Cookie Crisp.
B: KitKat?
A: Finger licking good,
B: KFC.
A: They're Grreat.
B: Frosted flakes?
A: OH YEAH,
B: Kool-aid?
A: We have the meats,
B: Arby's?
A: Have it your way,
B: Burger King?
A: Cookie Crisp your in good hand.
B: Allstate?
(Sing at same time) A: Cookie Crisp,
B: n-no no guys shut up,
A: Cookie Crisp,
B: n-no guys we can't do this this is stealing,
A: Ba Ba ba ba ba,
B: See this is clearly McDonald's this is stealing this what I'm talking about no guys we're gonna get in trouble, we can't keep stealing.
A:i'm Cookie Crisp, I'm coo coo for Cookie Crisp,
B: No, No it's Coco puffs guys,
A: they're Magically Delicious,
B: Ok look guys I don't want any part of this I'm leaving.
A: They're Magically Delicious, Silly rabbit, Cookie Crisp is for breakfast."
Lyrics:
1 likeA and B: "Cookie Crisp Cookie Crisp
A: Ba Ba Ba Ba Ba I'm Cookie Crisp.
B: Wait that's McDonald's.
A: I'm coo coo for Cookie Crisp,
B: That's Coco puffs
A: They're Magically Delicious,
B: T-That's Luck charms,
A: they're Magically Delicious,
B: what?
A: Silly rabbit, Cookie Crisp is for breakfast.
B: Ok that was Trix.
A: The cereal that smiles Back,
B: Goldfish.
A: they're Dangerously Cheesy,
B: Cheetos.
A: You can taste the rainbow,
B: that's Skittles.
A: I'm a Cookie Crisp Now.
B: H-HUGGIES!?
A: Like a good neighbor,
B: what?
A: Cookie Crisp is there,
B: State farm?
A: Cookie Crisp Gives you wings,
B: Red bull?
A: Give me a break,
B: what?
A: Give me a break of that Cookie Crisp.
B: KitKat?
A: Finger licking good,
B: KFC.
A: They're Grreat.
B: Frosted flakes?
A: OH YEAH,
B: Kool-aid?
A: We have the meats,
B: Arby's?
A: Have it your way,
B: Burger King?
A: Cookie Crisp your in good hand.
B: Allstate?
(Sing at same time) A: Cookie Crisp,
B: n-no no guys shut up,
A: Cookie Crisp,
B: n-no guys we can't do this this is stealing,
A: Ba Ba ba ba ba,
B: See this is clearly McDonald's this is stealing this what I'm talking about no guys we're gonna get in trouble, we can't keep stealing.
A:i'm Cookie Crisp, I'm coo coo for Cookie Crisp,
B: No, No it's Coco puffs guys,
A: they're Magically Delicious,
B: guys look I don't want any part of this I'm leaving.
A: They're Magically Delicious, Silly rabbit, Cookie Crisp is for breakfast."
0:56 OH, MY GOD IT’S VEGETABLES! WHAT’S WRONG WITH YOU?
0 likesThe song was hilarious
0 likesIn the background of the Cookie Crisp commercial you can hear the same kazoo solo from three little pigs by sml. Like if you noticed
1 likeThe background song from the commercial is Cody's apple tree song
0 likesI just realized something When Brooklyn guy When Brooklyn guy Makes the cookie crisp Commercial The I'm an apple tree kazoo Solo From the 3 little pigs video And the little boy who cried wolf
1 likeChef pee pee: junior do u want diabetes?
0 likesJunior: yes
Me: 💀💀💀🤣🤣🤣
"Roses are red"
81 likes"Violets are blue"
"This video's brand new"
"It got a view"
Replies (6)
Hehe..
0 likesK but https://youtu.be/AAIEb2JzufY
2 likesOk
1 likeOk?
1 likeOk but wtf?
1 likeSo good rhyming
1 like13:16 ”He like Lettuce guacamole, bacon…”
1 likeMe: I thought he was Jewish…
For real I watched them for 7 years
0 likesOnly OG’s remember when Mario and Luigi stupid and dumb adventures was a thing
0 likesHey I know this,, is very late but this is beautiful
0 likesCody sounded like a robot when he said 5 dollars
0 likesAlternate title: Junior and his friends commit felonies
0 likesI. Love. How. Cody. Is. Funny......🐱❤💛💚💙
0 likesC O O K I E C R I S P [woodpecker]
0 likes15:39 I love that game!!
26 likesI like how they kept this blooper in 5:21
3 likesOnly og's will remember Duffy O's
0 likesIt's funny how you can hear the part from when Cody sings that he's a tree
3 likesReplies (1)
i thought i was the only one that noticed
0 likesHe should have just bought a new PS5
0 likesI love the scenes where something unexpected happens and you just hear the crew laughing in the background
42 likesHow did the cop know Cody took the ps5 to his house
0 likes5:25 it look like bowser junior had an airpod on his left ear lol
0 likesBillions, thousands trillions, QUADRILLIONS!
0 likeswhen they said break off a pice of Cookie Crisp I was eating KitKat
0 likesI like how 10% of this was actually about cookie crisp and the rest was about the PS5
94 likesReplies (6)
Noticed How the video was 20 minutes long
5 likesBecause of course it was.
3 likesLol
0 likesRemember when this used to be mainly about Jeffy
1 like@B3LL glad it’s not
0 likes@Jeff Diaz We haven’t seen a SML video that long since Jeffy’s Parents
0 likesThe man on the comercial could name it healthy cookie crisp
0 likesHow does the guy know that Cody took the PS five to his house because he delivered it to Junior‘s house so how does he know Nick Cody took the PS five
0 likesLOL I accidentally sneezed when Junior sneezed in the video
0 likesI love cookie crisp
0 likesLove how they didn't cut the part where junior called Cody Joseph.
315 likesReplies (36)
@Ì Àm Ķēvïn BB no
3 likes@Ì Àm Ķēvïn BB no stupid bot
2 likesThey did that twice before
4 likesK
1 likeIk
1 likeYeee
1 like@Xyan Villl hi
1 like@Fakereal Jay wait what did he say
3 likesIt was probably because they were tired af and that was a long scene so they just didn't care.
2 likesThey might have done it on purpose
2 likeswhich part?
2 likes@Toxna hol up what did I miss
2 likes@Fakereal Jay what did the guy say?
1 like@ì Àm Ķēvïn BB
0 likes5:20 if u guys need the time
2 likesWho the hell is that
0 likesi just dont think they want to restart that entire scene
0 likesI think ur all right they might of done it on purpose
0 likes@Leland Morgan ye
0 likesWhat?🤨
0 likesYeah I know then they said ha I just called you Joseph
0 likes@Jaheim go to 5:20 in the vid and u will see
1 like@Lance's channel ye lol
0 likes@Fakereal Jay oh
0 likeswhat did the i am kevin bb dude say?
0 likes@Toxna ?what de he say he deleted his comment?
0 likesWhat did I am Kevin BB say coz he deleted this comment
0 likes@Jaheim wym what?
0 likes@Toxna nPapá papá ah
0 likesMaybe there soposed to?
0 likes@Verified_clips 05:20
0 likesIt’s cause it was a really long scene and they would have to do it all over again and that could happen in real life so they kept it in
0 likes@ShadeySean ik
0 likes@Mazin 34?
0 likeshttps://youtu.be/oZFAXdTMeXM
0 likesbro they sad “Joseph your gonna * giggles * I called you Joseph.”
1 likeHi guys love your videos!
0 likesi realized the song in the commercial is cody's I'm an apple tree song with no lyrics
0 likesHow did the Brooklyn guy know where the PS5 was now because he gave it to junior and it was at juniors house before
0 likesBrooklyn guy gave the ps5 at juniors house and now cody took it to his house how did Brooklyn guy know what house it was but the vid was still good
0 likesDamn this was a January video and it’s already one of the best this year. Great job I can’t wait to see more like this.
25 likesReplies (5)
If anybody would do me a favor and please sub to my YT? First couple subs get entered in a giveaway!
0 likesI thought it was February today but it was January 31
1 like@Sketty don't beg for subscribers
0 likes@Sketty why would I do that
0 likes@Sketty f u
0 likesWait joeseph has a tv? Yes I know the episode where Joseph has a mansion sorry for the ppl who didn't see it
0 likesGoodbye precious the cat always be remembered 2003-2022😭😭😭😭😭😭😭😭😭😭😭😭😭😭😭😭😭😭😭😭
0 likesSo I listening to the song and thought of "Cookie Crisp Is like.. Chips. a. Hoy
0 likesThe fact that even cheif peepee knows that broccoli for breakfast is gross
0 likes1:00 Cody brings back the wizard of oz moment
24 likesWhere she goes”I’m melting”
Replies (1)
He* but its fine
0 likesI love the song it's funny.
0 likesNo cap I would actually eat those vegetables and sausage because I use to eat it when I was a kid
0 likesSml question answer: Froot Loops
0 likesCompanies Use For JR,Cody And Joseph’s Cookie Crisp Jingle:
0 likes-McDonald’s
-Cocoa Puffs
-Lucky Charms
-Trix
-Goldfish
-Cheetos
-Skittles
-Huggies
-StateFarm
-RedBull
-KitKat
-KFC
-Froasted Flakes
-Kool-Aid
-Arby’s
-Burger King
-AllState
SML: Junior gets a PS5
209 likesSML fans: Didn’t Junior already have a PS5
Replies (52)
Exactly
1 likeProbably bc every episode pretty much is supposed to be a different story 😂
7 likes@Kirsten Dieudonne Lmaoooo
0 likes@X Vendevion I
0 likes@Kirsten Dieudonne same
0 likesyeah! he won it from the sml movie 'The Candy Salesman!'.
1 like@Kirsten Dieudonne shut up
1 like@DashW1z but I guess you can imagine whether Jackie chu called the cops or he just took it by force.
0 likes@Kirsten Dieudonne inappropriate
0 likesno because his teacher take his PlayStation 5 away because the coin is indeed fake!!!!
0 likesI feel like every sml videos are gonna be ps5 related until the ps5 stock is back
0 likesExactly my man
0 likes@Kirsten Dieudonne ya momma fell off a cliff cuz u said u didn't love ur mum
0 likes@Kirsten Dieudonne this comment should be banned ima report you
0 likes@RocksPetRock your nasty you should be banned
0 likes@BuiChaun you stole ma pfp
0 likes@StormFire10 sml isnt family friendly
0 likes@BIG3K what bro something wrong with a dude liking dick
0 likes@BIG3K you cant report for that, cringe ass pfp you got there btw
0 likes@BIG3K banned for what also?
0 likesexactly
0 likes@Leo Chaichana no....he gave away the ps5 box full of bricks
0 likesYup
0 likes@Kirsten Dieudonne wtf
0 likesHe cant get enough ps5's though
0 likes:0 yeah he did
0 likes@Kirsten Dieudonne gay
0 likes@Kirsten Dieudonne what the fu-
0 likes@Leo Chaichana he got a ps5 box full of bricks cuz junior gave him a ps5 box full of bricks
0 likesJunior has gotten 5 ps5s
0 likes@Kirsten Dieudonne wtf
0 likeshe had like 3 of them
0 likes@Kirsten Dieudonne tf??
0 likesYeah
0 likesJEFFY HAS ONE HE COULD JUST ASK HIM TO PLAY
0 likesYes
0 likesMaybe he wants another
0 likes@Kirsten Dieudonne Congratulations
0 likeshttps://youtu.be/aNOI2v5izN8
0 likesWhy is that true LOL 😂 😜
0 likes@Kirsten Dieudonne ur so gay
0 likesThank for the feeling.
0 likesBut later he came back for real.
0 likesuntil his Teacher knew it and came back for real.
0 likesWho else bought a stuffed toy cuz of sml
0 likesIt is puppet in real life.
0 likesIkr
0 likeshttps://www.youtube.com/channel/UCCWXO9zJSjhJvUzCwAeeSlg/featured
0 likeswhen?
0 likesYeah junior already have a ps5 on the candy sellmen video
0 likeswhat video?
0 likesOooo
0 likesthat song had me dyin
0 likes8:13 was that a moan?
9 likes:sml makes a vid
9 likes:me clicks really fast to be the first viewer
Didn’t junior already have a ps5 after he won it on that one video when he sold the most candies?
9 likes7:22 did Cody just kiss junior???!!!
9 likesReplies (1)
Yes 😂😂😂😂😂😂😂😂😂💜
3 likesI just adore how Jr. keeps stealing other companies slogans and jingles and just putting cookie crisps before or after it 😂😂
7 likesTimestamp: 6:11
Junior should have said "We have the TREATS" instead of "We have the MEATS"
8 likes5:24 😂 hats off to you for playing it off
8 likesReplies (1)
I called you Joseph
0 likes7:14 McDonald’s 😂
0 likes18:21 😂
1 likeThe slogan could have been "worth dying for" because of what they said before they saw the commercial
0 likesMy favorite cereal is Corn Pops
1 like5:38 the best song in the world
0 likesSML question:Apple Jacks
1 likeThe music in the cookie crisp commercial is the same one as the kazoo solo in the three little pigs video
0 likesI was eating KitKat while watching this: 6:53
0 likesI'm surprised he isn't CEO of cookie crisp
0 likesBUT HOW DID THE COP KNOW THE PLAY STATION WAS IN CODYS HOUSE HOWW
1 like2:20 COOOOOKIIIIIIIE CRIISP!!! 🤣🤣🤣🤣🤣🤣🤣
0 likesDarn this sml movie was long
0 likesGOD BLESS WHO IS READING THIS😍🥰
0 likesChef peepee spoke facts about himself
1 likeMine are Cookie Crisp, Fruity Pebbles, Cocoa Pebbles, Trix, Cinnamon Toast Crunch, Froot Loops, and Cocoa Puffs.
0 likes5:37 Cookie Crips Song
0 likesI love you guys cuz you make the best videos and Im10 and I watch your videos
0 likesThe start of Cookie Crisp song is 5:35
1 likeI liked the song it was funny
1 likeI heard Cody’s apple tree song and the little cookie crisp thing when Brooklyn T guy was asking for a new couch jingle I heard Cody’s apple tree song
0 likesCookie Crisp Jingle
0 likesNo Wait, Unlike The Wolf, Kids Can Eat Cookie Crisps
My favorite cereal is lucky charms
0 likesI keep singing the song
0 likesWhy did Cody want the ps5 when he cared about a telescope more then a ps5
0 likesI watch all of your vids
0 likes6:10 😂
0 likesI hear I am an apple tree song in the back when brooklyn is offering the contest
0 likes2:44 “Iiiiiiiim I’m an apple treeeee”
0 likesCody did like 30 for being backup singer and his funny joseph 50 and junior 50
0 likes5:35 sick rap
0 likesI think you should keep the PlayStation 5 Joseph no one goes to his trailer Anderson doesn't have any electricity and Joseph doesn't have any electricity Cody Cody's dad is probably going to take it and Bowser Junior they're always at Junior's house so I think junior said keep it
0 likesCocoa Puffs are made by General Mills and so are cookie crisps so they could have just said I’m coo coo for cookie crisp
0 likesI here the Cody I’m An Apple Tree song in the background of the commercial from Brooklyn T Guy
0 likesGosh dang that song slaps
0 likes@Toad manz he wished for everything he touched to turn into Cookie Crisp and he turned Thomas and chef pee pee and a bunch of stuff. I don’t remember the episode but I remember some parts
0 likes16:34 this is a reference of murder: to kill or not to kill. NO ONE NOTICED THAT?
0 likesthis video vas so funny
0 likesive bee nwatching sml for a year and this is the best vido ive seen
0 likesthe only good food chef peepee made ever
0 likesThis makes no sense Brooklyn guy said he is going to the house where he gave PSfive How did you know Cody had the PS five
0 likesI Saul it on my brothers iPad
0 likesMy favorite cereal is cinnamon toast crunch
0 likes😂😂😂😂😂
0 likesPersonally i would have taken the vegetables over the cookie crisp.
0 likesThey used the apple tree theme from 3 little pigs lol
0 likesI love the song it made me sub
0 likesi mean he owns lucky charms and is owned by general mills so he should have to the right to cookie crisp
0 likesU forgot a other lesson it’s don’t hit people with hammers
56 likesReplies (5)
Also don't throw a bowl of vegetables at a chef
0 likesRosalina sweats intensively
1 like@Venoxide ohhhh I remember that vid lol
0 likesIf anybody would do me a favor and please sub to my YT? First couple subs get entered in a giveaway!
0 likesPls sub to me
0 likesJunior said we have the meats I would of said idk but when Cody says Applebee’s than I knew
0 likesIt was funny win jr was singing about cookie crisps and it was a different phrase and Cody kept on saying the company
0 likesI love sml it helps me unwind and laugh and finish the day
6 likesi just realized this vid was uploaded after my birthday
0 likesMy favorite cereal is "Hitting Junior With A Hammero's" lol
19 likesy didn't they just say "THESE COOKIES R 2 CRISPYYYYYYYYYYYYYYYYY"
1 likeBruh i heard cody say "Spank it" When junior and joseph are spitting on veggies 1:48
0 likesI swear in 0:55 Cody and Joseph use Junior
0 likesHow many times did it take to get that sideways 🤣🤣🤣🤣🤣🤣🤣🤣
0 likesSml idea: Joseph moves in with Richard! Because they are all rich
52 likesReplies (8)
No it’s gunna be bad there gunna be assholes to getter and not going to be a good video
3 likesthats the opposite of being rich if you have to move in wiht someone
1 like@Megaboom Inc. Why can't you use correct punctuations?
1 likeI don’t think joseph being rich is canon
1 like@uncessor why can’t you use correct spelling?
0 likes@MilkJugs 1 i cant type and spell good with a half broken membrane keyboard, 2 u literally play fortnite and use autocorrect
0 likes@uncessor 1 I don’t use autocorrect I just know how to put proper punctuation and proper spelling. 2 you literally play roblox so idk why u getting at me for playing fortnite.
0 likes@MilkJugs i play roblox like once every few months just for 1 game, i usually play valorant and rust, 2 u didnt even use correct punctuation in your paragraph lmao
0 likesWhy did Cody, Junior and Joseph angry about who gets it since all of them can go to Junior’s house always every day they can go there and they also play multiplayer if they have enough money to buy two more controllers.
0 likes4:05 here is a nother one 5 doller cookie pizza
0 likesFrom now on I’m going to refer to LGBTQ as Lettuce, Guacamole, Bacon, Tomato and Quesadilla lmfao
0 likesBUT HOW DID THE POLICE OFFICER KNOW THAT IT WAS AT CODYS HOUSE 🏠 🤔 AND IT WAS AT JUNIOR,S HOUSE 🏠 🤔
0 likesThe part where they said I’m “cooco for coco puffs” actually sounded so good
41 likesReplies (5)
Fr
1 likehttps://youtu.be/O77XlKNsgEI
1 likeIs there violence in Superbowserlogan?
1 likeNo
1 likeHi login
1 likeThat is cool
0 likesShe's right Chuck e cheese need to see them factory electricity
0 likesThat beardrip on the song hit diffrent
0 likesAnyone notice that Joseph says he leaves his tv on
0 likesI was just watching sml pokemon series then i get to the end of part seven and i start to get annoyed because you guys said at the end of the video that it was to be continued so i search it up and there is no part 8 so am now really annoyed.
39 likesReplies (4)
That was a long time ago
4 likesno more series on sml
1 likeBy that I ment they could have still continued it on sbl
2 likes@Anonymous oh ok
0 likesMy favorite cereal is COOKIR CHRISP
0 likesAm I the only one who noticed that Cody's kazoo solo was played in the background of this seen 2:55
2 likesReplies (2)
yea as soon as i noticed it i went to the timed comments, we got sharp ears
1 likeI hear it :o
1 likeGod bless who ever is reading this you will be bless in life
1 likeGood & Cool
1 likeLogan , Can you plsssssssss make a day in a life of Mr.Goodman plsssss, people want you to make it , and I do to . What if he is actually poor !
47 likesThanks so much if you will make it .
Replies (11)
The Brick Empire will have full control of you.
0 likesOk first theres no way hes actually poor second they have recorded mr. goodmans house and I agree but I'd enjoy a house vid more but definitely one or the other
0 likesBtw I think its funny were both fans who make plush vids lol
0 likesI think we should have a video of Goodmans life
0 likesThe Brick Empire can hack you.
0 likeshttps://youtube.com/channel/UCdZSZbZTbZhOho36frgDLyA
0 likesHe's just gonna slip and fall and say "MY BACK IMMA SUE THE FUCK OUT OF YOU" that's about it.
0 likes@Phiyx The Brick Empire will hack you.
0 likesI was literally thinking the exact same thing and I was also thinking about them making a video on how he got so rich.
0 likes@Dudkover01 I control you.
0 likes@Important research What do you mean?
0 likes8:27 where did joseph get a tv
0 likesJust saying during the commercial it is the kazoo music from the the three little pigs video
1 likeI love you guys
1 likeChef pp: junior do you want diabetes. Junior: Yes
0 likes4:36 THATS EXACTLY WHAT I WAS THINKING
8 likesCody was strait for a moment
0 likesCall me weird but those vegetables looked delicious
1 likeReplies (2)
fax it does look good
0 likes@GhostToast ikr finally someone who doesn’t think like a 5 year old 😂
0 likesI never had that before
0 likesThis doesn't really make sense because when Brooklyn guy says he's going to get his PS5 back he goes straight to Cody's house but he gave the PS5 to Junior
0 likesOk so when bowser jr. told Joseph he could keep it at his trailer i was like don’t you mean mansion
43 likesReplies (8)
Wait your right
0 likesYeah Joseph situation for bj is kinda weird
0 likesBowser jr. forgot he had a mansion
1 likejoseph
0 likesBowser Jr. and Cody doesn't know the fact that Joseph has a mansion
2 likesJoseph gave B.J amnesia so he forgot that
2 likesY’all dumb joseph erased junior memory of the mansion 🤦🏾
2 likes@NA_LOWK3Y thats what i said
1 likeI kinda wonder why the hammer is curved 🤔🧐
0 likesThe funny thing is, is that when I was in a group for a made up commercial for my drama class, I was put in a group with people who wanted to make this highly inappropriate ad (it was for school). So I refused to be part of the ad and just offered to film some stuff for them. I talked to my teacher because I was scared she wouldn’t give me a good mark but she gave me a 10/10 because she felt bad. So I guess what I’m saying is that Cody also earned that PS5 because he was in a group with his stupid friends lol. But I really love all of these videos lol
2 likessml is good
0 likesI was eating cookie crisp I was watching it
0 likes3:20 why does Cody say why did you even bring a spoon when none of them have milk in their bowls 😂
10 likesmy favorite cereal is Lucky Charms
0 likesJoseph says he leaves his TV on whenever he sleeps but he doesn’t have power you lives in a freaking trailer
0 likes5:38 to 7:33 is the Cookie Crisp song
1 likeTotal Time 1 minute 55 seconds
-March 28 2022
I remeber when juionr wished for everything to be cookie crisp
0 likesThat Cookie Crisp song was amazing, hands down.
66 likesReplies (18)
Cody was ruining it
3 likesikr
0 likesSub 2 my yt
0 likesWhat's the instrumental?
0 likesFrl tho
0 likes@Ahmed AA What? Is that the name?
0 likesI laugh the whole time 😆😆😆😆
0 likesThis should actually be the new Cookie Crisp jingle. I don’t care if it’s illegal
1 likeI need A Version without Cody saying the brand names
0 likescody’s ablibs were perfection
1 likeFacts
0 likes@Krystal the Squirrel lololol no frl means for real
0 likes@didntask Oh...
0 likes@Lewis Johnson no he didn’t, I like his reaction to what Junior and Joseph were singing, without the Cody the song would be worse, this song this probably my favorite sml song
0 likesThoMS?
0 likes📱💻🌅🏡🐶🐺🐶🐱🐭🐹🐰🐸🐯🐨🐻🐷🐽🐮🐗
0 likesNo it was annoying as hell tbh
0 likesNo it’s a really bad song
0 likesSong low key fire drop the music video
5 likes"Don't steal?" Says the guy who brought a sledgehammer and knocked a little kid out with it smh😑
6 likes7:08 I love this part I’m not sure why
7 likes"Do you want diabetes"
6 likesJunior: yes 😁😁
When he actually gets diabetes:
😨😨😨😨😨😨😨😨😨😨😨😨😨😨😨
Who remembers the lamp and the Cookie Crisp accident happened 😂
7 likesReplies (2)
And Cody's wish 😭
1 likeI remember that
1 like2:42 in the instant he turns on the tv, i get an ad involving dolphins. What perfect timing
6 likesSML Idea: Bowser's Biggest Fear 4!
6 likesI love and understand "SML Movie: Bowser Junior's Cookie Crisp!
7 likesI LIKE JR WHEN HIS PLUSH PUT PUPET IS STELL GOOD
0 likesI remember that Richard
0 likesJunior: VEGETABLES YUMMY Chef pee pee: what the hell are you okay junior? you never liked vegetables -_-
0 likes2:20 COOOOOOOOOOOOOOOKIE CRISP
1 likeThat's true only ogs know that video I remember
0 likesMe having Cookie Crisp while watching this lol
10 likesonly just seen this and when junior turned on the tv the apple tree song was playing in the background
0 likesNot gonna lie those veggies looked soo good I’m 15 btw
0 likesThanks 😌🙏
1 like8:25 Joseph..has..a..tv. I thought he was poor hmm
0 likesI like how Cody knows the meaning of each slogan
26 likesReplies (2)
SML made videos on YouTube on chef pee pee good cooking
0 likesYea
0 likesREESE'S PUFFS REESE'S PUFFS EAT 'EM UP EAT 'EM UP EAT 'EM UP
0 likesI bought cookie crisp yesterday
0 likesmy siblings only ate oatmeal and nothing else 🥲 and we never finished it
0 likesI hear the apple tree music in the backround
1 likeHow does Joseph even have a TV if he is poor
0 likesGod is done with you yeet 😳🤣
0 likesLyrics of the song
0 likesBowser Junior}
Hey, Cody?
{Cody}
Yeah?
{Bowser Junior}
Let me tell you about the best motherfricking cereal you can buy
{Cody}
What is it, Junior?
{Bowser Junior}
Well, it’s these cookies that you get to eat for breakfast
{Cody}
For breakfast?
{Bowser Junior}
Yeah, for Breakfast
{Cody}
What’s the cereal called, Junior?
{Bowser Junior}
It’s called, “Cookie Crisp”
{Verse: Bowser Junior and Cody}
Cookie Crisp
Cookie Crisp
Ba da ba ba bah, I’m Cookie Crisp
(Wait, that’s McDonald’s)
I’m cuckoo for Cookie Crisp (That’s Coco Puffs)
They’re magically delicious (That’s Lucky Charms)
They’re magically delicious (What?)
Silly Rabbit! Cookie Crisp is for breakfast!
(Okay, that was Trix)
The cereal that smiles back (Goldfish)
They’re dangerously cheesy (Cheetos)
You can taste the rainbow (Yeah, that’s Skittles)
I’m a Cookie Crisp now (What? Huggies?)
Like a good neighbor (Wha-? What?)
Cookie Crisp is there (State Farm?)
Cookie Crisp gives you wiings (Redbull?)
Gimme a break (What?)
Gimme a break of that Cookie Crisp (Kit Kat?)
Finger lickin’ good (KFC?)
They’re great! (Frosted Flakes?)
OH YEAH! (Kool-Aid?)
We have the meats! (Arby’s?)
Have it your way (Burger King)
Cookie Crisp, you’re in good hands (Allstate?)
{Chorus: Bowser Junior and Cody}
Cookie Crisp (No, no! Guys, guys, shut up!)
Cookie Crisp (No, no! Guys, we can’t do this!
This is stealing!)
Ba da ba ba bah (This is clearly McDonald’s
This is stealing, what I’m talking about)
I’m Cookie Crisp (Guys, we’re gonna get in trouble
We can’t just keep stealing-)
I’m cuckoo for Cookie Crisp (No! No, it’s Coco Puffs!)
They’re magically delicious (Okay, look, guys
I don’t wanna have any part of this
I’m leaving) They’re magically delicious
{Outro: Bowser Junior}
Silly Rabbit! Cookie Crisp is for breakfast!
Thanks a lot god bless you
0 likesMy fav cereal is you can taste the rainbow 🌈 skittles
0 likesI seriously Let It Go Let It Go. I love
0 likesMy favorite is foot loops
0 likesim eating cookie crisp rn
0 likesI say about those vegetables toilet crap😂😂
0 likesJunior: This is America! Joseph: Yeah! Cody: YEAH! Joseph: Let’s spit!
7 likesThe major league delicious
1 likeWhat is it Junior
How does cody know all these companies
0 likesIn the song those places can’t sue them because they’re giving them credit
0 likesCookies (*UwU*)
0 likesIn the background of the commercial I heard the tree song
0 likesThe fact he’s talking about god up his profile in chuck💫
0 likesWho’s eating Cookie Crisp while watching this
0 likesSML:: ideas
0 likes:goodmen gets maried
:mario's dad
7:34 song ends
1 likewhen was the part that chef peepee murdered junior for throwing a plate at his head?
0 likesMy favorite cereal is chips ahoy cereal
0 likesOh wow 🤩
0 likes2:22 WTF IS WRONG WITH JOSEPH!
1 likeMr Goodman can you actually buy like millions of PS5s
0 likesHow did Brooklyn t guy know that it was at Cody's house
0 likesThis is a tutorial on how to get sued
0 likesJoseph has no electricity so how would he use it unless he's actually a millionaire 🤔😳
0 likesWhy would he want it 🤔🤔🤔😳😲😯😳😲😯😳😯😲😯🤯🤔
Wow!
0 likesMy favorite hero is Cookie Crisp
0 likesthats how the PS5s sold out
0 likesI love how they spit on the vegetables with a bowl and cody said yeah lets spank it! Lol 😂👌
6 likes🍪 crispy
0 likesI like Fruity Pebbles and cinnamon toast crunch those are the only cereals I like
0 likesmy favorite cereal is fruity pebbles
0 likesGOD IS GOOD GOD IS GREAT
0 likesRemember when junior called Cody Joseph
10 likesReplies (1)
lets see how many people would subscribe to me after seeing this comment Current--(207) You can help raise that number by subscribing to my channel
1 likeThat's it if people are going to eat us Cookie crisp we're going to eat those people that are human crisp
0 likesCodys song from the sml movie the play is the the backround of the commercail
0 likesiam eatting it rn
0 likesThe man gives the ps5 to jouniors house and went to kodys house dosent make sence but the video was super cool keep going
1 likeSML Idea: Mario's Mistake! Mario gets rid of all of Black Yoshi's stuff and steels his money for his house payment!
32 likesReplies (3)
actully where is black yoshi we haven't seen him in a while
2 likes@joseph bulla he was in a video like a week ago or two weeks ago
2 likesYeah almost every character has a mistake video. Toad has 4
2 likes2000 junior.s cookie crisp
0 likesGod bless you
0 likesGod bless you
0 likesI remember to all food was cookie crisp
0 likesIt seems obvious that drinking Red Bull will not actually “give you wings” as stated in the company's famous slogan. ... The case is based on a similar US class action settlement filed in 2013 by a pair of consumers who claimed that drinking Red Bull does not give you “wings” or result in improved performance.Aug 22, 2019
26 likesReplies (3)
OMG did you realize that nobody cares
3 likesNo shit
1 likeWow we never knew!
1 likeThe commercial with brooklyn guy has the song from cody's song in the three little pigs
0 likesThe song when Brooklyn guy is on the tv commercial in the background very quiet is the same song Cody sings to in his apple tree song sml movie three little pigs
0 likesCool
0 likesTv: 2:43
0 likesSlogan song: 5:36
When You’re Earlier Than The Bots:
40 likesconsider me jesus
Replies (5)
Xd lmao broooo?!!
1 likeXD
3 likesHehe
1 likeHehe...
1 likeHello hi hi hello hi 🙋🏿♂️ hello 👋
0 likes0:59 me when vegetable
0 likes6:42 Lol
0 likesI would never eat that vegetable
0 likesThank you very much
0 likesthey could have just said, "silly wolf, cookie crisps are for breakfast"
61 likesReplies (7)
Yeah
2 likesNah
1 like@RST Street Bmx witch one?
1 likeAnd they did that for another cereal brand
0 likeshttps://youtu.be/eRJ5ihFvAqE
0 likesthats not the point they were copying the slogan dumbass
0 likesKill bill epic
0 likesJuniorgooocookieCrisp
0 likesWe Need buy Cookie Crip for 10 dollars
0 likesGoodman: Bud Da bum ba ba I’m sueing it and I’m sueing you
0 likes2 tickets moment 3:28-3:44
0 likesSML idea: Time travel adventure
24 likesThey go back in time and alter their first appearances
Replies (2)
lucky theres a family guy
0 likesGood idea
0 likesBrooklyn t guy could of bought a ps5 because he got a raise
0 likes13:12 I never heard someone say "LGBTQ" in one of his videos or anyone's videos/live stream
0 likesThis is the last ever ep with the old toys sad 😔
0 likesHow did Brooklyn T guy know where the ps5
0 likesI like the fact, that the vegetables were probably rotten, guess the chef can't even make a salad XD
17 likesI'm back to the old vids
0 likesRichie is so rich can’t he just buy him his own ps5
0 likesCody should’ve stayed out of the song
1 likeDid you hear in the backround of the part of brooklin t guy was the apple tree song by cody
0 likesCookie Bear ain't gonna get any of my Cookie Crisp!
11 likesHow did Brooklyn guy know that ps5 in Cody’s house and it’s not in junior house
0 likesThey Couldn’t said cookie crips when the beat drop
0 likeshi and i love your vid
0 likesAt 0:43 It Sounded Like Mario Crying
1 likeCody: Vegetables are trash
25 likesVegans watching: No stop I can’t watch this
Me: YEAH
Replies (1)
scoffs vegans am i right?
0 likesThe fact is that they did not notice Cody saying let’s spank it is very weird
0 likesThey are literally just flexing their new consoles at this point. They made four vids including them.
4 likesThis is technically the last video with a music video with the Nintendo plushies.
5 likes17:13 KILLED ME😭😂
5 likes2:21 lol Joseph went Crazy
5 likesWoodpeckers Cookie Cruise 2:21 & 3:17
5 likesI’m Laughing 😂
Replies (1)
2:21 OMG he is woodpecker im dying 🤣 💀
0 likesSml: bleeps out cuss word
4 likesYoutube: DEMONITIZED
Sml: cop hits kid with hammer
Youtube: cool
Only ogs remeber when it was the purge OMG I WAS DYING LAUGHTER
4 likes15:40 IS THAT A JOJO REFERENCE?!
4 likesCan we just appreciate the beautiful singing from Jr
4 likes11:32 the sound of silence
4 likes3:17 Cookie: i believe i can flaaaaahh
5 likesI feel like chef pee pee is Junior day cuz he always taking care of him 😂😂
5 likesEverytime they post it makes our day 10x times better
4 likesNew sml its already 11:45
5 likesReplies (1)
Lol true
0 likes12:12 was there supposed to be a doorbell?
4 likes2:21 Joseph having a breakdown
4 likesReplies (1)
2:20 you mean?
0 likes6:21 Me: eating lucky charms right now
5 likesmy favorite cereal is now cookie crisp when junior made the song I was literally crying it was so funny he pretty much used everybody's motto.
4 likesSML Ideas: "Mario's new eyes!"
5 likesChef pee pee: do you want diabetes?
4 likesJr: YES
3:16 Joseph was eating like a woodpecker LOL 😆😂🤣
4 likes2:44 3:16 bro the three little pigs episode cody's song is in that part if anybody found this out before me let me know
0 likesThe song is beautiful
0 likesThe veges look good
0 likesI'm a og so I can remember that
1 likeI never tire cookies crisp
1 likeCop about to hit child: yesss😈😈😈😈😈😈. Child:I can smell u 🤫🤥
0 likesOH YEAAAAAAAA WE HAVE THE MEATS I also like the SILLY RABBIT COOKIE CRISP ARE FOR BREAKFAST
0 likes2:43 IIIIIIIIIIIIIIII'm, I'm an apple treeeeeeeeeeeeeeeeeeeeeeee, full of apples, and I make my own leaves!
0 likesjunior relly said "if colors can get arong than companys can get along"
0 likesI am also eating cookie crisps
0 likesJoseph has no electricity
0 likesLol at 6:52 if he just said give me a break it whould have been original
0 likesWe’re watching toys spit in a bowl of veggies
0 likesI wonder if they sponsored
0 likesBest crater ever
0 likesOmg bro i love the song
0 likesReplies (1)
I watched it 3 times
0 likesMy favorite cereal is Oreo
0 likescookie crisps
0 likesGot the ps5 like a month or 2 after
0 likesthis was like a year ago lol
0 likesThe most copyrighted song they ever listened to
0 likesCody didnt even hold the camera so he didnt do anything
0 likes10:36 Joseph is hypocritical
0 likesMan junior called Cody Joseph
0 likesI. Love. Ps5
0 likesJunior your literally copyrighting all commercial songs!!!! Now the companies will sue -_-
0 likesMine is Froot Loops
0 likesAnd we will get a ps5
0 likes18:42 * Whack * 😂
1 likeJosef is def me when I eat serole
0 likesWhy did the cop go to Cody’s house when he dropped it off at juniors house
0 likesCOOKIE CRISP
0 likescookie crisp
0 likes😂
0 likesJunior doesn't get cookie crisp starts 7 world wars
0 likesCOOOKIE CRISP
0 likesTegen Uzui: Junior You Are Goldy
0 likesCherrios because i can ask jeffy if he wants them and ask him to also take all the green beans and blow them all up
0 likesCookie 🍪 crips
0 likesSML.Question Cookie Crisp
0 likesMy favorite cereal is with a Videos name is just cut out Junior
0 likesI have jeffy
0 likes🤣😂
1 likeCOOKIE CRISPSSSSSSSS
0 likeswait wasn't Joseph holding the camera cuz Cody was in the song
0 likescookie crisp is my favourite and ! goodman is not the ceo of all the company
1 likeWhy didn't he bring up the cheesy part?
0 likes¹²³⁴⁵⁶⁷⁸⁹¹⁰
0 likesCookie crisp
I am watching this on 2022 lol
0 likesThe real lesion don’t steal a ps5
0 likesI love this!!
0 likeshappy birthday sml video anver for january 30th
0 likesA miss my cat she died a year ago so i put this song do cheer me up 5:38
0 likesHow did they get in his house
1 likeCookie crisps
0 likesChief PP always talks about killing Junior but I guess today he wants him to not get diabetes and possibly die from it. What a good lad.
5 likesI like vegtables accually but not all of them-
0 likesCody should,ve stayed out the song
0 likesCody‘s weird af
0 likes2:14 for the week
0 likesSML Answer: dog treats, they taste great in milk so it counts
5 likesDude feed them eggs instead
0 likesjeffy😘😘😘
1 likeI would kms if they stop uploading I love them like w all my heart
0 likesThis video is about to be a year old
0 likescookie crisp
0 likesDon't you think if Cody was a nerd he would enjoy vegetables? I mean that is just my opinion. Not sure if it's true though. Just saying..
0 likesIf you’re good at hearing you can also hear Joseph singing in the main chorus so I say Joseph deserved the PS5 he wrote it and also sang…
3 likesmy favorite cereal is Cookie Crisp
0 likesSML idea: Cody gets a real boyfriend and can you make more playtime
4 likes0:08 lol
0 likes5:24 lol
6:04 - 7:34 is the whole song
I like broccoli 🥦D:
0 likesJunior: VeAgAbLeS UgH
1 likeYour Gonna Get A Hammer Head On Your Big Head Guys
0 likesu cant out crisp the cookie😈
1 likeThe OG I am the OG he only wished for the food to become cookie Chris in the world I remember that I am a OG
0 likesbring b yoshi back
0 likesWhy is jeffy so expensive
0 likesJoseph: "i leave my tv on"
5 likesMe: YOU DONT GOT A TV G YOU POOR
Replies (1)
Remember he was secretly rich
0 likesMost iconic video of the year to me
4 likesMe be like: Oh yay a new sml sees it is about Cookie Crisp, I know what I must do
3 likesMe: garbs a bowl of Cookie Crisp, perfect.
2:21 me when i dont have any schoolwork
3 likes2:13 junior really said "i like your cut g"
3 likesHere's an idea what about Cody the wrestler where Cody gets in love with wrestling
3 likesJunior was right
0 likesCookie chirps
0 likesOn the commercial it’s Cody’s apple tree. Song
0 likesMy favorite cereal is McDonalds
0 likesHuggies 6:42
0 likesGOD IS GREAT
0 likesHE MADE US YALL SHOULD BE GREAT TO HIM 😇😇😇😇😇😇😇😇
Cookie crisp
0 likesSml idea: Bowser junior goes to the waterpark
3 likesThis video doesn’t make sense because brooklen guy gives the ps5 to juniers house and he takes it from codys house
0 likesOH MY GOD ITS A VEGETABLE WHATS WRONG WITH YOU!
0 likesIn the 3 little pigs by sml the sound in the ad of good man and Cody's kazoo solo I only just realised
0 likesMy favorite cereal is chocolate
0 likesCooookie crlsp!!!
1 likeGod bless
0 likes😂😂😂🤣🤣🤣🤣😱😱
1 likebackgroumd song when brooklyn guy is Like the im an apple tree
0 likesYou should have said you cant out cookie the crisp
0 likesgoodman could buy 2millions ps5
0 likesI’m eating Cookie Crisp right now 🤤🤤🤤
1 likeJunior's c🍪🍪kie crisp
0 likesMore like
C🍪🍪kie's c🍪🍪kie crisp
1:45 4:11 4:56 5:49 5:24
Ba ba ba ba ba I'm suing it🤣🙆😂
0 likesBro he voice cracked at 16:23
1 likeCookie crips
0 likesKind of look like my neighbor
0 likesFun Fact: The part that junior was trying to get the ps5 back and brooklyn guy trying to hit him with a hammer is called Murder Be The King its a game where a guy is trying to kill the king so that he/she is trying to be the new king if the guy got caught trying to kill the king then he/she has been thrown in a dungeon.
1 likeTyrone should be encouraging Cody but get away dork
0 likesThe lesson for you is dont hit lil kids with hamers
0 likesAmen ❤️🙌
0 likesIs it just me or does it sounds kind of good when Cody names all the references Junior makes in the song? 6:51
5 likesReplies (1)
I agree
0 likesI feel so bad cuz lovelle didn’t get to be in the music video
0 likes"Hey Logan What Doing"
0 likes🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣hahahahaha
1 likelol i have a ps4
0 likesBruh that song had me weak😂😂😂🤣🤣🤣
4 likesCount Chocula!
0 likesveggies for breakfast? 🤮
0 likesNotice cody tree song is playing in the Commercial
0 likesWhy did brooklyn take back the PS5 when he hade the raise
0 likesYou can’t out crisp the cookie
0 likesKennedy's heart
0 likescookie crisp
1 likeCooookie crisp
0 likesThis is one of the best SML Movies in a while.
5 likesReplies (2)
subscribe to me right now why my video is going to premiere on power ranger dino fury The Official Premiere date reveal
0 likes@GamersForceRevice785 what
0 likesOne dollar five dollar cookie crisp is your job
0 likesTrue
0 likesLol
🤔 littorly best youtubers
0 likesIn the world!
That’s a boom boom
0 likesI was literally waiting for this I checked the channel as soon as this dropped I’m like it’s a Saturday there should be a video 😂
5 likesHI I'm a big fan
0 likesThe longest slogan EVER !!!!
0 likes0 likes
JUNIOR HATES THE FIRST FLOOR
1 likeEvery time SML uploads it’s going to be a good time 🥺✨
3 likesIm CoCoE FoR CoOkIe CrIsP
0 likesHow did he get to Cody’s house they were at jrs. House…
0 likescookie crispe is on your side.
0 likesCookie Strawberry
0 likes😮😂
0 likes1:49 😭
1 likesml question my answe: coco pops and im eating then now while typing this
0 likesSml is the best
0 likesGod betrayed me
0 likes0:00 intro
0 likesHe said why dose pizza get a hut on 4:30
0 likesSpread the gospel
0 likesCookie crisp
0 likesHi I am happy to watch SML so plz say Hi?
0 likesBro a once in a lifetime I got an ad on a sml video
0 likesnice
1 likeI was just watching a sml video right before this was uploaded I can’t wait for the bts
3 likesI don’t have a favorite! I don’t eat cereal
0 likesReplay what your first sml video
1 likeMine sml movie Jeffry’s pet shark
Why does everyone die and come back to life
1 like⛑Cookie cookie it’s union vegetables to be strong so you can get help
0 likesremember when they did an episode similar to this?
3 likesWhy is it always nighttime outside?
0 likes🤩🤩🤩
0 likesIn the background of the commercial of cookie crisp the background music was kazoo solo from the tree cody
0 likesReplies (1)
i was just about to say that
0 likesWoo woo cookie crisp yea yea yea
0 likesis it my state or country, but i never ever seen a pizza hut ad
0 likesreese cups cereal good
0 likesThen how about this Talking about Logan and what he's doing How old you are you quit talking to people like that that's with before you need Be honored and thankful
1 like0:17 UUUGH!
0 likesGOD IS REAL
0 likesGod bless all of u
0 likesPapa Papa cookie Chris
0 likesOOF😂 2:20 3:17
0 likes19:03 outro
2 likescinnamon toast
0 likesPeople who says only og’s remember aren’t og’s
0 likesI want a MG you guys are the best you have should make a video where jeffy becomes evil like he starts breaki
0 likesng the door and Why do you have to be so rude to Logan and his friends and stuff you always say why is son don't do that I don't talk to someone like that loser
You guys I like the People in the world
The Mad returns with a kid and says it chef pee pees
3 likeslucky charm
0 likesThey are magic delicious silly rabbit Cookie Crisp breakfast
0 likesHahaha
0 likesI thought Cody said he didn't have a goldfish in Bowser Juniors revenge, I guess he actually wanted one
4 likesMe: It's Cookie Crisp Time!
3 likesCookie Monster: COOKIE!!!
16:36 - 17:00, When you get in trouble at school but you think that your mom didn't find out
3 likesBro after the incident when cookie crisps where ruling the world and they are not traumatised Lmaoo I love these comedians
2 likes13:16
3 likesflash back to chef pee pees birthday
I thought in Cody’s culture he couldn’t eat pork..
When you get here before an hour: YAHOOO
3 likes10:10 i like how jr forgot that Joseph is rich
3 likesSml idea: Chef pee pees old life
3 likesSml idea: Jeffy the Pooperman
3 likesSml idea The Camp trip: So Mario and bowser want to spend time with jeffy and junior so they went to go camping and chef pee pee went to and they were going to make smores but they needed wood for the fire and jeffy went to go get wood and he got attacked by a tiger and Brooklyn guy is hiking and saw jeffy getting attacked and threw sticks and rocks at the tiger and ran away so Logan please do it please.
3 likesonly ogs rember this vid
0 likeswhy did cody's dad say cody likes bacon i thought they cant eat pork
0 likescookie crisp
0 likesyou cant out cookie the crisp
0 likesCooooooooooool
0 likesWhy does the song actually sound good
0 likesReplies (1)
Trueee
0 likesHi junior and jpsphep and Cody
0 likesits fuuny when junior called cody josph
0 likesDon’t knock out people with a hammer as well
0 likesFor the sml question my favorite cereal is cheerios because it has a hole and jeffy likes cheerios so yeah and then you know what to do with the hole 😏
4 likesWhy dose it say Cody’s apple trees
0 likes1:23 YOUR NOT 20 YEAR OLD
0 likesFood brand and then state farm 6:42
0 likesElon musk has more than that
0 likesMy favorite cereal is... DEEZ NUTS
0 likesPoorrrrrrrrrrrr !!!! ------Goodman
0 likesHhhhhhhhh🍪🥣No 🍲
0 likesOkay one Brooklyn t guy on his commercial in the little background of the music you can hear kazoos like in The Three Little pigs by sml
0 likesSanitarium Week-bix bites honey 🍯 🥣
1 likeReplies (1)
What do you think guys I like the cereal
1 likeCoco puffs
0 likespp:DO YOU WANT DIABETIS junior:yes
0 likes🤩🤩🤩🤩🤩🤩🤩💯💯💯💯✌🤟
0 likesjust saying this makes no senece cause how does the cop know the PS5 is at codys house?!?!?!
0 likes7:33 jacki chu. DING DONG
0 likesi agree with ya
0 likesjeffy is so cool i like win jeffy said pp
0 likeshow much copyright was in this video
0 likesIF JEFFY SAW A JUMP SCARE HE WOULD SAY that scared the living shit out of me WELL YOU GOT ME SHIT HOAL!😡. Sorry this has nothing to do with this
0 likesLucky charms is owned by general mills and so is cookie crisp what is goodman talking about
0 likes8:43
0 likesCoooookie crissssp
0 likesIsn't it Joseph poor
0 likesVegetables?!?!!? UHGGGGGGGGGGGGGGGGGĢG!
0 likesGod bless you to😇😇😇😇😇😇❤️❤️❤️❤️❤️❤️🇱🇷🇱🇷
0 likesI swear Joseph should not get it because he wasn't even in the vid
0 likesIf colours can get arong companies can get along (and the arong was not an accident)
1 likeWhere the alternative ending
0 likesWhy couldn't Mr Goodman just buy it , its like 800 or 500 dollars he has like Billions
0 likesMe when I Haven't Eat in 6 Hours: 2:20
3 likesHoney Stars...
0 likesmy is honey puffs I LOVE U JOSEPH
0 likesCody is right they literally copied McDonald's Lucky charms Cocoa Puffs kit Kat goldfish Pizza Hut Trix Skittles Cheetos Huggi's State farm Red Bull frosted flakes etc. So it makes sense why they got sued in the end well for some reason Brooklyn guy almost got sued not Junior but still it makes sense why they ALMOST got sued I wish Cody was there to rub it and Joseph and Junior's faces of how stupid it was to copy all those companies
0 likesCinnamon toast crunch
0 likesOMG
0 likesThe song tho
0 likesI'm Fading!!!!!
0 likes,y fav cereal is cookie crisp I have it at home
0 likesYa I remember
0 likes5:50
0 likes5:37
0 likeswow
0 likesDoes anyone notice 3:13 the background musik??? XXD
0 likesI'm hungry
0 likes😱
0 likesWell cats die for being too skinny and not feeling well 😭😭😭😭😭😭😭😭😭😭😭😭
0 likesIn the back room music it I’m a apple tree
0 likesYou can’t out cookie crisp
0 likes🎶 Cookie Chris Cookie Chris Cookie Chris Cookie Chrisssssssss🎶
0 likesBut cookies aren’t bad is still good
0 likesI never thought I’d be this early to an sml vid-
2 likes6:44
0 likes5:38
0 likesUkulele = ook-ooo-leh-leh
0 likesCan you please send me a jeffy puppet anyway wear dresses NG5 2LJ wondering I've got blonde hair blue eyes and my name is Phoebe
0 likesFools! Both of you! Silence!
0 likes7:33
0 likesDo you guys Jeffys is mom Drop his mom and then You guys would be so famous
0 likesThis is swearing
0 likesYes
0 likesFirst of all you still said cookies that you can eat for breakfast, secondly what’s the slogan again? And third and least important is that it’s all copied honestly that last one shouldn’t be there
0 likesSix
0 likesCrapy
Hours
Of
Our
Life
2:20
0 likesWait that makes no sense he didn’t give it to Cody so how did he find his house
5 likes6:04
0 likesYea Cody only said that because he like jr
0 likesYep
0 likesYes
0 likesMe reacting to bowser junior at the beginning: “laugh hysterically”
101 likesReplies (21)
Notbgoodenpigh
3 likes😃
4 likesokay then
1 likesubscribe to me right now why my video is going to premiere on power ranger dino fury The Official Premiere date reveal
0 likes@Toonsterz Troll :D #RoadTo300
0 likesHi
@Chima Finaboy hi what do you want
0 likesWhat the
0 likesWhy is this user so underrated “@GamersForceRevice785 “
0 likes@GamersForceRevice785 how ho ho sub to him
0 likesFor some reason
0 likes@Toonsterz Troll :D #RoadTo300 hehe
0 likesI love sml
0 likes@GamersForceRevice785 no
0 likesTom and Jerry
0 likes@GamersForceRevice785 why
0 likes@Chima Finaboy same
0 likes345
0 likesStfu
0 likesI started watching 2 years
0 likes@Sean Freij why what did i do
0 likes😂
0 likes19:03
0 likes0:03
1 like3:25
0 likes6:03
0 likesSml idea: bowser watches charlie and friends as usual and then charlie meets his biggest fan its not bowser so bowser meets up with him and finds a way to proove to charlie that hes his biggest fan
3 likesa ps5
0 likesthat broccoli bowl honestly looked really good
1 likeHi I have been working with my dad for the past three years and he
0 likes16:34
0 likesSML Movie Idea: Goodman goes Bankrupt!
42 likesAfter losing his job on the news due to the rise in the cough cough cases, Goodman has no other option but to sell all of his other businesses because he can no longer afford them. So, he has to move in with Mario! And to Mario's surprise, theres a lot more to Goodman than a house payment collector.
Replies (11)
Uesss that one right there
0 likesThis sounds like a good idea
1 likeBasically kinda happened in the beat video / Goodman vs chef peepep cook off
1 likethat is dumb. His son shits money for crist sakes and he has 2 🤷
0 likes@Marco Espinal Thank you! ❤
0 likes@boredd. 退屈 Err... kind of except for the fact he didn't move in with Mario and go bankrupt
0 likes@Greg the Unicorn Well, his kids might get taken off him from social services 🤷♂️. I mean, I'm sure they'd have questions if the kids were literally pooping gold bricks and money. Anyone in the right mind would be concerned. It's not being dumb, it's being creative. Having an imagination - an imagination is clearly something that you don't have.
1 like@Ashton Eastwood I have better things to do than argue with a child
0 likes@Greg the Unicorn Then why reply in the first place? 😂😂
0 likesThat should be a vid
1 like@The crafted God Thank you!
0 likes0:55
0 likesOh On Cody
1 like2:20
1 like9:06
0 likesI love how cody said that the penny will not stand-up but it actually did
3 likes3:10
0 likesYeah Jeff
1 like6:04
1 likeBest regards at work
0 likesCoOkIe CrIsP I started dying when Joseph said that and started eating his Cookie Crisp like a woodpecker
6 likes7:08
1 likeI know I’m like a year late, but I have one. “Early ? Don’t be a b|tch, try Cookie Crisp !” (Doesn’t rlly rhyme but it works)
0 likesIt’s the rap
0 likes6:17
0 likesSml idea. Please like if you want them to see, I'd appreciate it. :D
4 likes[Insert rich kid name]
A video about Richard meeting a richer kid then him.
(Also, "oh hungry, oh cookie crisp")
0:54
0 likes😜
0 likes7:14
0 likesYeah but the Cookie crisp song was a bunch of slogans that you mixed together and you copied people they did that because they need a company you don't need a company you just want to Xbox just copying off of somebody song and lyrics
1 likeWhy are you doing something instead doesn't belong to you boy that isn't what Junior have to do you understand being smart okay and Kobe shouldn't be gay if I watch this one more time
Joseph was not able but he had to go back panel for a 3 to the extreme rising costs in a
0 likesLol
0 likes13:10
0 likes1:00 just nothing
0 likes15:48 omg add pop up and said am Spider-Man
3 likes18:21
1 likeMY LIFE🤩MY RULES😃MY STYLE💅MY ATTITUDE😎YOU LOVE ME❤️OR HURT ME😔 I DONT CARE😒BUT DONT PLAY WITH ME👺
0 likesTyrone the liar
1 likeTyrone the liar
1 likeMy favorite cereal is Lucky charms because there magically delicious
5 likesWe have the meats is Arby’s
0 likesLol
0 likesSml reuploaded is the best canl
0 likeswhy did jr thorw the boll at cheef pp
0 likes2:10 best shot
9 likesReplies (1)
360 no scope
1 like5 dollar 5 dollar cookie crisps
0 likesMy mom thinks Jeffy is funny
1 likelongest sml video
0 likesMuñequitos is the best of all
0 likesI love the scenes where something unexpected happens and you just hear the crew laughing in the background XD
16 likesReplies (2)
Time stamp?
0 likes@Vibin’ Guinea pig 5:21
0 likes8/10
0 likesThis is f****ng great
0 likesThe PS5 controller is not on so the PS5 is not on
0 likesCody said spaink it
0 likesI like when Cody says "what's it called junior" even tho the box is right in front of him
51 likes5:54
Replies (2)
It was even funnier when Cody even looked at it
1 likeit was for the song intro
2 likesMario And Jeffys mom Get together with
0 likesjeffy
0 likes2:14,18:42
0 likesI like honey bunches
0 likes"You can't out cookie the crisp" honestly that was clever
234 likesReplies (30)
Here before this gets more than 1k likes
7 likesSame
1 likeSame I guess
1 likeyup
0 likesI'm too
0 likesI’m here too
0 likesUse me as the like button
2 likesHere before 1k likes and btw this is rare af for Logan to like ur comment
1 likeSame
0 likesMeh not really
0 likesWhat about:
0 likesYou cant out crisp the cookie crisps
yea
1 likeSame
0 likesYra
0 likesHe got heart he’s gonna get video game because he’s funny
0 likes@THY G.O.A.T III w
0 likesYou can't out crisp the cookie
0 likesYou can’t out crisp the Cookie
0 likesTis true
0 likes@Sabina Britannic cool
0 likes@Madcat Videos just said that a week ago
0 likes@Tute never did
0 likesSame
0 likesSame
0 likesSame
0 likes😉😉😘😚😚😚😚😚🥰😚😚🥰😚😚😚😚😚😚😚😚😘😘😘🏞️😇
0 likes@Tute shut up
0 likes@mxm1 frr
0 likes@Tute It won't. But same.
0 likesJunior don't want his invisibles
0 likesI heard in the news in the video I am an apple tree music
0 likesThe bingo
0 likesIs this song on iTunes or any song app's
0 likesfroot loops ;)
0 likesThey got the ps5 at joiners then the cop went to Cody’s like what
3 likesI like you
0 likesJr kills chef pee pee and gets arested
0 likes2:21
0 likes12:26
0 likes5:37
36 likesBrowser JR, Joseph- Cookie Crisps ft. Cody (Offical Remix)
Replies (2)
K but https://youtu.be/AAIEb2JzufY
1 likeNo thank I don’t need links pls stop
1 like15:14
1 likeThe first thing I saw the video from sml
0 likesCinnamon Toast Crunch
0 likesYes sir
1 like•junior-:I don’t know how I ended up here. •friends-:bitch were the good good‼️💯
6 likes6:11
0 likesi love it
1 likeBest
0 likesI am sueing you to my favorite cereal is lucky charms
0 likesWait technically good an is sueing himself since he's the CEO of everything
63 likesReplies (9)
“im not the ceo of cookie crisp” lol
5 likes@Ì Àm Ķēvïn BB why
3 likes@Tripple he wants views
2 likeshttps://youtu.be/O77XlKNsgEI
1 likehttps://youtu.be/O77XlKNsgEI
1 like99% of y’all won’t see this but I hope you’re having a great day🥰
2 likesI’m a small content creator & make videos & it’s my dream goal to get to 2k of yt friends for my birthday in February❤️
That’d mean alot to me if you can check my channel out☺️❤️
@Lol.cosmic wtf
0 likes@gwyn true
0 likes@Rhythm Panchal no he wants hate comments because he is protecting himself because he is being bullied
0 likesSML don't do that about vegetables vegetables bring nutrients and they are really good for the environment but you are what's wrong with Society and if you're wondering how I got to that part I would just given everything to see how what happened but flip you sml
0 likesCheerios
0 likes🦋🦋🦋
1 likeA single pea
0 likes16:33 reminds me of this game called Murder
7 likes2:26
0 likes12:26
0 likes🤯🤯😳🥺😻😻
0 likesCody doesn’t the ps5
1 like0:54
19 likesCody. Ewwww
Joseph. Oh my god it’s vegetables what’s wrong with you
Cody. Oh god I’m melting
I can relate to that very funny😂
Yes
0 likes7:77
0 likes19:03 ba ba ba ba I’m suing you
0 likesJustin was kind of good but really good me
0 likesSML Request: Woody Returns!
12 likesReplies (4)
Yes but you know it just gonna to be jeffy and some jr
1 like@Just Rodriguez hater
1 like@Claret And Blue⚒️ that reply made no sense to what he said
1 like@Claret And Blue⚒️ he just spoke facts the vids are only gonna revolve around the two main story characters and it wouldnt happen I think we all know it would be nice to have woody returns tho hes not hating
1 likeThis video is officaly 1 year old
0 likesyes
0 likesChef pee pee is a bad chef!
0 likesBro didn’t even hold the camera
0 likesHow did guy figure out that the ps5 was at Cody’s house when he delivered it to jr.
5 likesReplies (1)
Good point
0 likesI like your name
0 likesI’m eatting big bowl cereal I think he right I might get diabetes
0 likesAll true og people remember mario and Luigi stupid and dumb adventure’s
0 likesIts just that. WHY WOULD YOU SAY SWEAR WORDS IM 8 AND I CANT BE HEARING SWEAR WORDS AT THIS AGE!
0 likesI love how when juniour hit the remote, it sent me right into an ad
5 likesReplies (1)
Same, good ad timing
0 likesBc never ref were the same thing I thought it would have happened in my first place and was going on the way to get the ball in his pocket for
0 likesCody made the song so much better.
0 likesNO NO NO NO you can't eat vegetables for breakfast
0 likesChef peepee
1 likeThe few, the proud, the crisp
5 likesmy fav cereyal is miny wheast
0 likes1:40
0 likesJUNIOR GMVNVNVKCKCCKXCKCVKDCKFKFKCVVMVNVVMMVMCMCMCMCMVMVMVMVMVNBVVNNVMVMVVMVMGKGKVGMGMGNFNGMGNGMGVMGNVNNVVMFKDLFMDLVMFVMVMCMCMDMCFFMDFKCFKCKVNGKKCCMVMVMVMCMCMCMVVMVMMWHYDOTHIS!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!
1 likeJunior: I'm a cookie crisp now
73 likesCody: WHA HUGGIES!!
Replies (5)
yup they said that
2 likesEtter
0 likesG you we to
AdrianZ.
0 likesSI QUIERES INTERESA
Junior lPS5 get $20 you have it
0 likesI would like this but it has 69 likes
0 likesI lovethe song it’s really funny
3 likesI think Goodman meant to say my son does want ANOTHER PS5.
2 likesReplies (1)
No he said “my son does want the new ps5”
0 likes2:14 that just had me dying XD
17 likesReplies (2)
2:20 COOOKIE CRISPPPP
1 likeHi
0 likesPoll: Who should get the PS5?
1 like6:40 Haha I’m a Cookie Crisp Now
2 likesThis video made me so hungry for cookie crisp
0 likesI remember that sml movie
0 likesi like it :)
0 likesThe fact that the ps5 was at cody's house but the ps5 was at juinors house at first. how did brooklyn guy know it was at cody's house?
0 likesI got a good slogan for Cookie Chrips cereal! Here is my slogan: "Cookies are Cookies just like your cooking!".👍👍👍👍
1 likeReplies (1)
I Love it! :D
0 likesRemember when Jeffy sat there for a hour looking at a fence
0 likes8:28
0 likesJoseph "sometimes i leave my tv on when i fall asleep"
Me "MAN'S TO POOR TO AFFORD ONE"
Replies (1)
Remember he was secretly rich?
0 likesI love this vid
0 likesI would be like damn that broccoli
0 likesi was eating cookie crisp while watching this
1 likeOfficer Brooklyn: The lesson today is do not steal
4 likesAlso Officer Brooklyn:*Steals his PS5 back*
Replies (3)
Well it was ps5 to begin with
0 likesHis
0 likes@demon he literally gave it to them though
0 likes16:34 THE FACT GOD WAS WATCHING FROM BEHIND
0 likesWait, I thought breakfast was the healthiest part of the day???
0 likesthis is the last sml movie with the actual nintendo characters
0 likesI was eating Captain Crunch while I was watching this
0 likesMy favorite kind of cereal is Cheerios with real honey nut
0 likesSml is the best show even after the breakup
0 likes13:08 Cody’s dad said lettuce twice
0 likesOnly Og’s remember when chef pee pee started junior asked for Mack and cheese that day I know because I’ve Been watching for 5 years
0 likesJr : Coookie Crisp Coookie Crisp bala a
0 likesCody: That's McDonalds
no only ogs remember when chef pee pee made junior macaroni
1 likeCookies oh cookies COOKIE CRISP!! Included not real cookies magically delicious 😋
0 likeshe dropped it off with jr so he went to Cody
1 likeGood job you got a ps5
0 likesI thought Goodman was using the swear words when he is suing Bowser Junior for copying the restaurant names
0 likesMy dumbass just realized Brooklyn guy should be rich with all those jobs😂
0 likesI watched this and ate cookie crisps
0 likesThis video is so cool
0 likesIn the song instead of saying "silly rabbit" they should have said "silly wolf" because it's a wolf not a rabbit
0 likesI miss these videos
0 likesHe's vegetables for breakfast while just sleeping you must be a bad chef
0 likesI'll give some1 2k if you hey guess the right amount off times Joseph said "he's a doll dude "
0 likeshey if goodman is "so rich" then why wound he just own the world
0 likesLucky charms 😋
0 likesWhen chef pee pee said do you want diatbetes the way he said it just made me laugh idk why
0 likesCookie crispssss there magical delicious
0 likesPlease make more cool videos
0 likesat 4:55 Jr says if colors can get a wrong then company's can get along
1 likei love the song
0 likes2:21 Joseph: THE CRISP!!!!! bangbangbangbang!
0 likesBest video ever
0 likesTHIS WAS THE START OF LOGAN GETTING SUED
0 likesI cant stop laughing!!!!!!!!!🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣
1 likeYou should make a video of juniors mom
2 likesHow did he know it was at Cody house
0 likesBut Cody also sang too... a little bit
0 likes“Why doesn’t orange sue the color red, because they look similar.” Technically orang is a son to red and yellow.
0 likesI remember it
0 likesTHANK GOD THIS CHANNEL DIDINT GET DELETED
0 likesdamn jr got aim #sniper 2:10
0 likesright as junior did the state farm one in the song i got an ad that was state farm
0 likesI remember that
0 likesI remember that
0 likesMy favourite cereal is lucky charms
0 likesI. Like the part when Junior said you cannot outhuntthe cookie ChrisBecause The mascot is a wolf so like the hunters the hunting the. Wolf
0 likesCookie Crisp is Small pieces of cookies
0 likesbrake me off a peace of that cookie crisp
1 likeDid we just mist the part when Cody dad said Xbox 5 and its a ps5 wow
0 likesMine is coco pops and cookie crips!!!!
0 likesJunior: ew vegetables. (chef pee pee:. Junior do you want diebeaties?(junior yes. (Selever that part mede me laugh so much
0 likesJUNIOR>JEFFY IMO
0 likes2:20 COOOOOKIE CRISP Proceeds to start an earthquake
0 likes2:20 COOOOOOKIE CRISP
0 likesWhen cheff peepers took the Cookie Crisp away junior said I can’t eat vegetables for breakfast eww that’s growing
0 likesHow does Brookey now where Cody lives
0 likesWhen he sang the song I was saying it of what it was from
0 likesCouldn’t they just said the cereal you could die for
0 likesBut I'm sure you don't get sued for a parody
1 likeI like Junior because he keeps on annoying Cody
0 likesA boogie man box hehe so funny
0 likesNice
0 likesjunior:COOKIEEE CRISPP COOKIE CRIIISP BUDA BUB BUB BUBB IM COOKIE CRISP
0 likesKnow what my favorite cereal straight up is tricks but my mom can’t buy it because it’s illegal
0 likesAnyone realize it’s 7:50 PM at night
0 likes4:12:
0 likesJUNIOR: Ok, a footlong sounds like something you’d want, because you are Jewish and you like feet. And Jewish people have a foot fetish!
(JOSEPH and JUNIOR laugh out loud)
CODY:
Junior, I f***ing swear to God if you make one more joke about my mom or my religion, I AM LEAVING!!!!!!!!
JUNIOR:
What are you talking about?
JOSEPH:
Yeah dude, what are you talking about?
CODY:
Oh come on! All you ever do is make jokes about my mom being fat. Plus, you also call me names and rip on me for being Jewish!
JUNIOR:
Cody, I know I make jokes about your mom but when have I ripped on you for being Jewish? What am I, the fat kid from “South Park”?
CODY:
Well, you act like him.
JUNIOR:
BULLSHIT!!!!! I’m not acting like the fat kid from “South Park”!!!!!!
CODY:
Yes you are. This is just like the last game night we had where you made jokes about my mom and Joseph’s mom. Remember?
JUNIOR:
I’ll stop making jokes about your mom, but I won’t stop making jokes about you being Jewish.
(CODY punches JUNIOR in the privates)
JUNIOR:
OW, HOLY F***ING SH**!!!!!!
CODY:
JUNIOR, SHUT UP!!!!! I HOPE YOU GET A HEART ATTACK!!!!!!!
i have the ps5
0 likesIf you ever wanna punch junior but you can't then click this
0 likes|
V
17:13
You Never Fail To Entertain Us ❤
39 likesReplies (1)
:O
3 likesA bot
But it's nice
Sus
whenever they censor n word it’s ninja
0 likesHow is y’all gonna say that Cody held the camera when he was the one in the video singing with junior Joseph was holding the camera because he wasn’t even in the video so that scene didn’t make sense at all also Joseph don’t even have electricity so how the hell is he gonna play it at his trailer y’all don’t think think before you speak or record
0 likesWhy is that so funny to me idk why 0:17
0 likesMy favourite cereal is frostys
0 likesjeffy better watch out because juniors raps are getting better
0 likesJr coulda just took the Cookie Crisp and dip chef pp wasn’t even paying attention
0 likesWow
0 likescookie crisp
0 likesBruh he did not go to Cody's house he went to juniors house😐
0 likesbro what god man could buy some of his own
0 likesYou can to cookie the crisp
1 likeYou should of said silly wolf Cookie Crisp
0 likesyou could have said no one out cookies the crisp
0 likesmy favourite cereal is tricks 🤭😋😋😋😋😋😋😋
0 likes🥵🥵🥵🥵🥵
was brooklyn just playing murder with jr
0 likes13:15 Cody like bacon??? I though he was Jewish
0 likesThey can do more chocolate chip cookie taste
0 likesWhat if they where sold out
0 likesCOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOKIE TASTE!!!!!!!1!1!1
0 likeswait this was the last Bowser junior video
1 likeThats facts
0 likesMy faviroute game is tic tac toe
0 likesNo no no no, the lesson of the day is not to hit guest with a hammer and be mature to them, yeah sounds about right!
0 likesJoseph:Ooooooo Cody:what no it's to similar were gonna get u
0 likesSued for copying
it was soo funny that my plater had no more controle and pisst my self
0 likesIn stead of Super Mario Logan it should be Super Mario Slogan
1 likePS5
0 likesThe musique super cool
1 likeSongs fire
0 likespls dont waste food :(
0 likesDid he say bacon,🧐
0 likesThats the burger episode but its fact
0 likesIS JOSIPH A BIRD
0 likesWho is still playing with the ps 2 and Nintendo wii
0 likesCinnamon toast crunch
0 likes7:49
0 likes3:53
0 likesLol
0 likes7:10 😂 I’m laughing so much
11 likesDamn man I’ve watched u since u started. You’ve made my childhood😪
3 likesReplies (1)
Me too
1 likeTHIS IS THE ULTIMATE SPONSORSHIP
3 likesThey stole lyrics from other companies
0 likesAny episode and I’m mean ANY EPISODE with Goodman for me is automatically a AMAZING video!!!
13 likesReplies (2)
Haha!🤣 same here
2 likesAgreed
2 likes10:34
0 likes“Cookie crisp.. is rightly delicious lol”
21 likesReplies (1)
Nika
1 like8:08
0 likes13:43 Cody gold fish that he loves so mutch he really did have one lol lmfao
4 likesReplies (2)
Ooooh from the bowser junior’s revenge video
1 likeYeah
1 likejunior: for the last 6 months u get to keep it at ur trailer
10 likesme forgetting that joseph has a mansion
Replies (1)
True tho
1 likeCookie cris
0 likesThey forgot to say “cookie crisp what’s in your wallet”
60 likesReplies (8)
Cookie Crisp: Happy Taste Good!
1 like“Coo Kie Crisps, mmmm!”
0 likes@Phoenix wright A.K.A. the original slogan
0 likes?????????
0 likesCookie Crisp: Where A Kid Can Be A Kid
0 likes“Unleash the Crisp”
0 likesYour profile picture is the one I used to have on my PlayStation account
0 likes@Nate yeah I made it my logo because I already use it on my PlayStation account and I think it’s not copyrighted or trademarked lol
1 like5:15
0 likesJunior: Let’s watch tv!
35 likesMe: Gets an ad
Replies (6)
LOL
0 likesSame that happened to me to ha
0 likes@Kevin Pooni 😐
0 likes😐
0 likesSame man
0 likessubscribe to me right now why my video is going to premiere on power ranger dino fury The Official Premiere date reveal
0 likesAm I the only one who also corrected Junior’s "slogans" when the song dropped?
8 likesTell me:
Replies (1)
Hif
0 likesAt then end when it said “what is your favorite cereal” me literary eating Cookie Crisp while watching the video
17 likesReplies (1)
Other than that. You where eating cookie crisp while watching this too
2 likesWhy did mr Goodman take the ps5 I hate mr Goodman
1 likeTHIS IS SUCH A GOOD VIDEO LOGAN!! best one in a while the song has me cryinggg especially the huggies part 🤣🤣🤣
3 likesReplies (1)
Nice profile picture
0 likes2:20 why...
0 likes12:26
0 likesMe tryna be first:
6 likesMy wifi: You thought haha
Goodman could have just bought another ps5 he has like millions so he cwn buy enything to be ohnet and i dide t even know the mac advert went like bubububaba im macdonalds like LOL HAHAHA LOVE UR VIDS btw im a big fan i try stoping my selff from ur vids beacouese my mom and dad td me to but i do it enyway beacouse i cwnt stop myself im a BIGGGGGGGGGGGG FAN LOVE UR VIDS DO YE kh and. If u do shout outs pls let me be one of 3m love jr vids i say that alot but ye!!!:)
1 likeSML idea: Goodman's mistake! Goodman accidentally sends all of his money to charity!
34 likesReplies (4)
Yes!!!
2 likesyessss
2 likesPerfection
1 likeHe is too
0 likessmart to do that
18:21 My favorite part from goodman
37 likesReplies (3)
@Sisters4life💖💜 SML IS ENDING THIS YEAR For 15 Years
0 likes@Montel Gathers cap
0 likes"Bada ba ba ba I'm suing it" got me rollin 🤣
0 likes12:24 I literally came back to this video JUST for this 🤣🤣🤣👍🏾
8 likes14:38 Junior knows where brooklyn guy lives because when he went christmas charoling inside the south pole santa video.
3 likesI have that stitch magnet but it's a keychain 17:01
3 likes1:48:
24 likesCody: A little spanking
Junior, Joseph, & Cody: What
Replies (3)
lets see how many people would subscribe to me after seeing this comment Current--(207) You can help raise that number by subscribing to my channel
2 likesHello everyone
3 likeshttps://youtu.be/yazne6gVz7I
0 likesThe best part of waking up... is cookie crisp in your cup! XD
17 likesI like the funny part when Junior would have got sued or using all the slogans that were copyright
31 likesLogan: posts a Cookie Crisp vid me: hey this reminds of the lam-
62 likesReplies (3)
K but https://youtu.be/AAIEb2JzufY
0 likesThe lamp
0 likesHe did one with cookies too👍
1 likeCookie Crisps-Get em' while they're crispy!
47 likesReplies (4)
@Tjay On the binds thanks
1 likeWell they going to be crispy anyway😂
1 like@Jay Mehta exactly lol
0 likesThe profile is amazing with the comment
0 likesSo... is no one going to remember the time when Junior wished for everything to be cookie crisp? Because this is more or less like the sequel for it xD
49 likesReplies (9)
Ok
0 likes@Ì Àm Ķēvïn BB what in the heck are you trying
0 likesTo say
0 likesHello everyone! I'm sorry for Self Promoting but I'm fixing to have Surgery and it would be nice if you all helped me hit 10k 😊
0 likesHehe...
0 likes@IanKava your banner says AlienZGamer, so that story is incredibly hard to believe. Not only that, but I’ve seen many comments like yours from different channels. And also, what will subscribing to you do? That only gives you dead subs, which is terrible for the algorithm. If you need subs that badly, try this concept called making videos that people can watch without dousing themselves with gasoline. Quit your bullshit.
2 likesAh yes the reply section that has nothing but bots in here
0 likesYou don't know what a sequel is
0 likesikr https://www.youtube.com/watch?v=iWfOTbaufqQ
0 likesThe song tho its actually kinda good
3 likesOnly the OG‘s remember Mama Luigi’s death
2 likesI love how at 11:15 he didn’t even knock over the quarter
6 likesNo no no no 😯😂
0 likesHow’s that “after you” video going?
6 likesOr will it become like the sml movie, ceased to exist
0:01
0 likesBlue and purple
0 likeslol
0 likes3:27 oh god not this again I still have flashbacks from 2 tickets
62 likesReplies (4)
I remember that too... Oh Gosh...
3 likesI remember
2 likesNo the trauma
2 likesSAME
0 likesI feel bad that Cody can never have anything nice 🙁
53 likesReplies (2)
he didn't earn it though. he really did just try to discourage them
2 likesBut they were going to get sued for this song
2 likesi know
0 likes“huggies?!?” XD
10 likesLOL I was eating Cookie Crisp while watching the video!! 🤣🤣🤣
3 likesI got a slogan “you can’t ignore the munchy crisp!”.
94 likesReplies (10)
A slogan for Logan LMAO!
3 likesnot bad, not gonna lie
0 likesI can
0 likesNo
1 likeMy Coco puffs is munchie crunchy chocolaty
0 likesBad
0 likesI got one “you can’t ignore the munch crisp!when you can have a bowl of Cookie Crisp!
2 likes@Jonghyeon09 that’s your opinion if you have nothing nice to say don’t reply And If Your Just Gonna Call It “Bad” Be More specific tell him why it’s bad and what he can do to make it better
1 likeHahah
0 likes@Among me YT! yeyeye
0 likesThe vegan teacher would be proud of chef peepee for making him eat veggies..
25 likesReplies (4)
Oh yeah she would be proud of that
0 likesThose veggies look kinda good tho
0 likes🤢🤮
1 liketrue
0 likes6:39 “I’m a big kid now” is actually Pull-ups, not Huggies
24 likesReplies (7)
ok who asked u
0 likesHuggies makes Pull Ups.
1 like@A.J. Marcantonio oops, my bad, sorry
1 likeok
0 likesits called huggies pull ups sooooo
0 likesITS THE BRAND DUMBASS
0 likesHuggies is the name of the company that creates pull ups to imbecile
0 likes9:04 if you look in the background it’s night and at the beginning jr said Cookie Crisp for breakfast and it’s night😉🤔
4 likesReplies (1)
Well it probably took a bit for them to win it but its still weird
0 likesHi I am going out and will see you
0 likesjan 30 is my bithy day and it was posted on jany 30 yayyaya
0 likesI was eating Cookie Crisp while watching this
5 likesThat’s abuse cuz he hit a kid with a hammer
0 likesYes
0 likesFrosted Flakes
0 likesDid you guys do the kit Kat like gimme a break of that Kit Kat
0 likesMcdonalds 6:10
248 likesCocoa Puffs 6:16
Lucky Charms 6:20
Trix 6:26
Goldfish 6:29
Cheetos 6:32
Skittles 6:36
Huggies 6:39
State Farm 6:42
Red Bull 6:49
Kit Kat 6:52
KFC 6:57
Frosted Flakes 6:58
Kool Aid 7:00
Arby's 7:02
Burger King 7:03
All State 7:05
Replies (24)
Thx
4 likesThanks you
4 likesLOLOLOL
2 likesy? 😂
3 likeswhat is this
3 likesI like how it’s lucky chars, exc is copyright when it’s the same company
3 likeslol im gonna like
0 likesThx
0 likesWhat
0 likes@Guest it’s funny…that’s why😌
0 likesDoes It Look Funny How They Put Arby's In The Cookie Crisp Lyrics
1 likeTy
1 likeLol
0 likes@J Vargas it’s supposed to be a joke.
0 likes@XItsAmeliaaX Would It Be Funny Or Bad If There Is Meat Or Cheese In Cookie Crisp?
0 likes@J Vargas It would actually be funny because it would be a JOKE but there’s no meat or cheese in cookie crisp it’s meant for a joke.
1 like@Toji
1 likeThey’re the names of the companies they stole the slogan from
why would anyone do this
0 likes@XItsAmeliaaX Would Meat Or Cheese Taste Good Or Weird If It Was In Cookie Crisp
0 likesWhy?😂
0 likesThx
1 likeThx but y?
1 likeYou had no reason at all to do this, yet you did. I'm very proud of you for that very reason.
0 likesHow did you write this?? It is sooooo lòng
0 likesWhy is this song so catchy what the hell
0 likesYes jr is dead
1 likeWhy didn't you just say famous Cookie cri
0 likesCall me cookie crush like you
0 likesJust addicted to the videos bro love them 😂❤️❤️❤️
3 likesWtf is this and why did it pop up in my recommendations, I hate YouTube algorithms
0 likesYou have a PS5 PFFT nothin compared to my PS3
0 likesWork figurines
0 likes#McDonaldsHacks
0 likesDoes anyone else realize that Cody’s dad said that Cody likes bacon and their Jewish
62 likesReplies (5)
Halal has entered the chat
2 likesthere is turkey bacon...
4 likes@HaramHeisenberg
2 likesHaha
lol
2 likesAnd their jewish..... What, exactly?
0 likesgood for you vegetable or very nice😊😊😊
0 likesyessss ogss
0 likesThe lesson is don't hit a kid with a hammer!!!!!!!!+
0 likesLogan what about jeffy and he gos to having
0 likesPov: Jr remembers. (That Joseph is rich)
14 likesReplies (2)
@JAVIER VILLAMARIN so that jr. and Cody wot think him as the cool kids and just like. Him for his money.
0 likes@JAVIER VILLAMARIN I know
0 likesMy cereal fav is cpt crunch
0 likesDon't steal but you just chilled
0 likesCooooooookieee criiiiiiiisp
0 likesGod Bless you to let god. Bless your soul
0 likesCoco hoops
0 likesWe love sml
1 like2:20 Joseph: COOKIE CRISPPPP *having a seizure*
4 likesOr don't hit people in the hammer when they won something.
6 likesHow did Brooklyn t guy knew the ps5 was at Cody’s house when he gave it to junior at junior house
2 likesI love this video so much I would actually really love this place and I love all of the SNL videos it’s just perfect and I like when it said cookie crisp time cookie crisp time
10 likesReplies (1)
its sml not snl
0 likesMy favorite cereal is Reese puffs/cookie crisp 🤗
0 likesThose vegetables look hella tasty
0 likesI had an ad when junior turned on the tv it was hilarious
0 likesOnly the ogs remember when junior was doing the Pokemon mission
0 likesThat low-key looks really good you cooked the vegetables just the right way
14 likesReplies (1)
Frr4
1 likeThe videos are funnier when the guys laugh during it
0 likeslove the way junir goes like...UUGGHHH
0 likes2:20
0 likesMy mom eating vegetables be like:
How would Brooklyn guy knows that the PS5 is that Cody‘s house if he delivered it at Jr‘s house?
0 likes6:03-7:33 is so cool
0 likes20:00 is way to funny
1 likeThat song was absolutely amazing
4 likesthe best song all year XD
0 likesLmfao 😂 2:22
1 likeToad Manz be telling facts
0 likesI just now thought of the cookie you can’t out crisp or the 3 c’s of Cookie Crisp
1 likeProof Joseph was lying he said tv even tho he broke
1 likeTHAT VIDEO IS A 10\10
0 likesIn Junior’s Planet, Cody said that the PS5 didn’t sound cool to him, and in his bedroom, he said it was cool, so I think he changed his mind.
3 likesCody is getting better at being funny love sml am a fan
1 like9 months without the Nintendo plushies 😔
0 likesThe song is 🔥🔥🔥🔥🔥🔥🔥🔥
0 likesChef peepee: do you want diabetes?
0 likesJr: yes.
Did anyone notice that when Brooklyn t guy gave his ps5 to Junior and he what’s it back he randomly knows that the ps5 is at Cody’s house when he gave it to Junior
0 likesHonestly I think Logan should get the ps5 cause he holds the camera comes up with the video ideas and plays 2 characters
6 likesReplies (1)
elaina comes up with the ideas. Also, there’s people with more roles than two
2 likesHow does Joseph got a spoon if he’s literally poor
0 likesJunior said that I'm going to sing with my beautiful voice but he thinks that he's only going to get the ps5 and he said that he is only going to play it for 6 years but bruh thats a long time he just wants to keep it for a long time.
1 likeSML idea: Jeffy and Junior play cookie Clicker
1 likeMake sure it's number 2 or 3.also pls pin
If you ever do another scene with Joseph eating. You should put a lighter to the spoon and say he found it In the garbage outside
0 likesjr: bruh chef peepee get out my home
2 likeschef peepee: hell no
Jr friends came:sup Dude
chef peepee: uhhh yeah I will cook you some cookie Chris
Chef peepee Whispers : do not tell your friends to kill me
jr: ok fat boy
Cody: wats going on jr are you saying your going to sleep or wat?
cody: my baby is sooo gay like me
Joseph and Jr: he's a doll dude
Cody: he's not a doll
Joseph: yea he is cody
Jr: 1 2 3
jr and joseph:HE'S A DOLL DUDE!!!!
aggressively eats cookie crisp
0 likesRight after junior said silly rabbit cookie crisps are for breakfast I got an add for the ps5
0 likesMy favorite cereal is Cookie Crisp it’s magically delicious ba da da da daaa
4 likesThis is one of the last few videos where the Nintendo plushies are used unfortunately.
0 likesLove how you made a song from
0 likesSml idea: jrs oreos
0 likesI remember it was called The Lamp
0 likes0:16 Bowser Junior: VEGETABLES!? EEEEEEEUGH!!!!!!!!!!!!!
1 likeEach one should have 4 months of the year cause 4x3 is 12, there is 12 months in A year so each one should have it for 4 months
0 likesCookie Crisp is SO NICE
0 likesI remember that video
1 likeGoodman just doesn't want to waste his money over a ps5 he just wants to save his money
1 likeMy fav cereal is Reese's puffs
0 likesGuys give me a break of that cookie crisp
0 likesWhy is that the best looking thing chef pee pee made?
0 likesI'm a cookie crisp now wha- huggies
0 likesI remember that
0 likesYo that was a coolest song ever
0 likesOh and one time I was eating cereal and I was chugging the whole box in the little plastic toy fell in my mouth and I almost choked and died
0 likesMy favorite cereal is honey bunches of oats
0 likesJust stop arguing about the ps5 and do Rock paper scissors shoot
0 likes9:54 this shows that the joseph being rich video is canon lol
1 likeMy favorite cereal is chips ahoy
0 likesYou should go to the zoo for Jeff’s birthday
0 likesWhich Cereal you Prefer Lucky Charms or Cookie Crisp
0 likesBowser jr is so greedy he was gonna play the ps5 all day even if his friends got it
0 likes6:03 play on two times speed
2 likesCody:Let’s Spank It
0 likesEveryone:What
Cody:I uhh I said let’s spit on it
there you goooooo
2 likesoh no a boogie man box!
0 likesJust think of how much time they got sued
0 likesYou can taste the rainbow
0 likesvegetables go crazy gotta get that protein
0 likesI have many favourite cereals
0 likesYour brought it back the videos
0 likesWait but Cody said he didn’t have a goldfish
0 likesYesssss
2 likesNintendo cereal system
0 likesYou cant out crisp the cookie
1 likeCookie Crisp
1 likeCody’s family is Jewish and why his dad say he like bacon
2 likesmy favorite cereal is honey nut cherrios
0 likesWow
0 likesBroh I also thought Brooklyn was poor that's why he has so much jobs
0 likesI loved when Joseph eat the cookie crisp😂😂😂😂😂😂
0 likesBubba bum bum bum magically delicious silly rabbit cookie Crisp
0 likesfor breakfast
Silly wolf cookie crisps are for breakfast
0 likesNo say I’m coo cooo for Cookie Crisp it’s magically delicious ba da da da daaaa
5 likesReplies (1)
Yeah, I said it so?
0 likesWait if Joseph thought about that isn't he homeless so does he have a TV how does he have enough money he is homeless how does he know all of those commercials so how does he have a TV cuz he's homeless it doesn't make sense right whoever sees this
1 likeCody Said Little spanket idk how i spell spanket but he said that i did it on Slow speed
0 likesCINNAMON TOAST CRUNCH
0 likesCookie cripsssss
0 likesMy favorite cereal is marshmallow mateys
0 likes🤑🤑🤑
0 likesHahaha
1 likeWow 200k perfectly
0 likesI want to eat vegetables because it makes you skinny
0 likesCo co pops are my faviroute curious,
0 likesIt is cookycrisps
0 likeswhy didnt he just tell his dad
0 likesI thought this was, “juniors alligator problem”, when he said im going to throw these away.
0 likesI remember
0 likesGod bless to the 1% who see this comment….
1 likeYes
0 likesI’m just saying dogs can die from chocolate but they can eat chocolate it just can’t be the 75 percentage or more of the actual chocolate been
0 likesSML is about to get sued by evreything
0 likesDo you know your Channel I like your channel it’s the best one in the world I will join in and makes a video about out of wreck room
0 likesIM GOING TO SUE THIS MADE ME GO DEAF.
0 likesCody can’t eat bacon cause it’s meat and their Christian… 🤦🏻🤦🏻🤦🏻
0 likes20:20
0 likes40:02
0 likesLol
0 likes19:03
1 likewhy did he only take the controller....
0 likesMy name is Cody
0 likesSO HE DOES HAAVE A GOLDFISH
0 likes6:39
0 likesHow do you spell SML movie not out
0 likesYep
0 likes0:55
0 likesWhy are they eating without milk
0 likesI know a lot of people have already forgot, but we do realise whenever Joseph or another character says or calls Joseph's poor or anything related to it, just don't know about rich Joseph.
3 likesReplies (1)
Hi
0 likes6:39 I laughed so hard when junior said “I’m a Cookie Crisp now”😂🤣😂🤣😂🤣😂🤣😂🤣
16 likesReplies (1)
What ..huggies
0 likes7:14 depressed mcdonalds
3 likesI'm just here before the change it😔
3 likes13:11 he cant like bakon he is juish
2 likesSml idea
3 likesThe king of shrimps
Mario is eating shrimp fried rice when woody walks in with a gun and shoots mario who was a shrimp in disguise and the shrimp hisses at woody and goes away down a sewage drain and woody follows the shrimp in a shrimp costume where woody finds out there is a shrimp hq in the sewers where woody finds the King of shrimps
Shrimpo senior the first who sees woody and tries to kill him but woody dodges and the shrimp king gets stuck in a pipe and woody pulls out a fork and eats the shrimp king and throws a hand grenade at the base and the hq explodes but a defence league of shrimps follow woody and woody knocks with a boxing glove
Logan can make up the rest
SML IDEA: chef pee pee cooking is good! chef pee pee after all these years he leard how to cook 5 star!
7 likesReplies (2)
The name should be chef pee pee learns how to cook!
0 likesThank you for his feeling.
0 likesYea the lesson is today is don,t steal and don,t hit kid with a hammer on his head
0 likesChef Peepee: Do you want diabetes
23 likesJunior: Hell yeah
Me: Wtf
Replies (7)
Hehe..
0 likes@IanKava lm reporting you because you keep on spamming the same thing
0 likeshttps://www.youtube.com/watch?v=iWfOTbaufqQ.
0 likesFinally he's gone
0 likes@graham cracker get a life
0 likes@FadingCoyote574 you can tell he lying after he deleted his comment
0 likes@Cringe Animations when people say that why do people say get a life
0 likesZ a a z z
0 likes/
Don't say oh my god ur using his name in vain
0 likes"This is America"
96 likesThe Canadians and Brits are triggered. Fee Fee!
Replies (17)
lets see how many people would subscribe to me after seeing this comment Current--(207) You can help raise that number by subscribing to my channel
2 likes@MrMajestic 209 now
1 likeLol
1 like@MADDEN Videos 210 actually
2 likes@MrMajestic earn ur subs
2 likes@MrMajestic don't beg
2 likeshttps://youtu.be/O77XlKNsgEI
1 likehttps://youtu.be/O77XlKNsgEI
1 like@Lol.cosmic No
2 likesIm canadian lol but like 10 mins away from america.
1 likeIm a canadian and im not triggered tho
1 likeIf anybody would do me a favor and please sub to my YT? First couple subs get entered in a giveaway!
1 like@Deku Midoriya Fee Fee!
0 likesYay! Look at all these likes!
0 likes@Hubby from eTV I'm British
0 likes@Elliot Pelenc Fee Fee.
0 likes@Hubby from eTV ?
0 likesDon’t they have school?
0 likesYup
0 likesSML idea Black Yousie gets kicked out Mario is sick of black Yousie asking for call of duty and for all the other times that he did it
8 likesReplies (1)
Wow next sml video video should be
0 likesSml: black yoshi's cod cold war or something
Logan I have a SML Movie request since you already did The life Brooklyn Guy I was watching old SML videos and I seen Mr. Goodman as a cop and I was wondering how did he become rich.
6 likesI love the part where Cody stops singing and look at Jr 😂
42 likesReplies (7)
Dfhjhvhhxgstsfffgfigx
3 likesMdftfffdfsrdfsvh
@Dorothy Wallace ???
1 likeDfhjhvhhhxgstsfffgffigx Mdftfffdfrsdssvh
1 likeDkakkskskskakakakakkalalalalasjsjnxnxnakaijxjsnnxdhdb,x,sosfjehowos c cjeisnsjsisiwbwiwhrhrnejwiakakajsndjdjwiqiejdjmfkslqwmmdmdmnsnqnwmmdismq wojwnsjwhw wwkjaaqjqjqhhamqjajsmmakkqkakaakkakqkakakjdneiwjwhesmnsjnsihsiwjs,h hadj,na jqhjk
1 likeNaimaniaojwjaijwonxyhej1amjxhuyi
FrjefnjjhedjefjbdvjndcjbcJwinwjwkjwnwuihwihwuhsuisuaijiaiqjijiaunsiuaiajkznininainaihaunaihsjnsjiqlwhirihryryhrnsmcjfirbndbfetydhjhfej,wikwdnkwdiwdwdiwdh)Danes njnzbcmncdsahbxb is qsjhwdhihsb usnuwyxnwwnzwnx7nkjunsuyisdXhwudyqysemjhd
@Kaidaxz shut up
0 likes@zanetr7th ok
0 likesMatthew is beast
0 likes5:37 I’m putting this on my top 3 favorite songs 😂😂
9 likesReplies (4)
5:23 was a real blooper 😂🤣
2 likesThe only song that has a bunch of crossovers, other than the ultimate showdown
0 likesKinda sucked
0 likes@OvalThomas 123 what that was the best song
0 likes5:29 jr got crazy grammar #junior #iluvSML
3 likes5:38 This was lit 💀🔥
66 likesReplies (2)
Chef pee pee is a evil villain on this video and a secondly antagonist of this channel
1 likeTrue lol
0 likes20:4
0 likesI love how he calls cody joseph on accident and pretends like it was planned lmao
4 likes1:22
0 likesWe know a cookie or 2, because we’ve seen a crisp or 2
5 likesI’ll expect my royalties in the mail soon
😅
0 likesI wonder what Cody’s gonna do with that Foot-Long :>
9 likesReplies (3)
Mean while at cody's house
1 likeCody with the footlong: m o a n
@one bizzare user wtf
0 likes@one bizzare user I-
0 likesVideo idea: Shrek’s toilet paper problem
31 likesReplies (3)
but Shrek is not in sbl any more
1 likeThey already did that bruh
1 likeThat makes no sense
0 likesLittle did Cody know, they wouldn’t get sued by any of those food companies, but they would get sued by Nintendo.
24 likesReplies (4)
I hate your profile pic
0 likes@Brady P1ay5 shut up
0 likes@Brady P1ay5 yeah shut up
0 likes@Darien Webster do you want. Yay for the update on new update. Wolf. Yay yay lol I just saw it on the way lol I love the one I want lol I think it’s funny how it looks lol lol I think lol I was
0 likesThe song where they were stealing other slogans had me dying of laughter
18 likesReplies (1)
lets see how many people would subscribe to me after seeing this comment Current--(207) You can help raise that number by subscribing to my channel
3 likesJunior eating Cookie Crips
10 likesFlashbacks from the SML Movie The Lamp
Replies (3)
Oh Yeah,The lamp was from super luigilogan
1 likeHahaha yeah
1 likeOmg fr
1 likeRepent from your sins before is too late
0 likesI love how Joseph had a mental breakdown
16 likesReplies (1)
me to
1 likeI love how Joseph is sing along
47 likesReplies (8)
😘🥰😚🤼😇
2 likesIt’s Joseph
2 likes@Donna Dubois oh thanks
4 likesYour welcome
3 likesSame
2 likes@Donna Dubois isn’t that the same thing?
1 likeI don’t know if it’s Joseph or if it’s Cody
1 like@Trent Biro sounds like toad
0 likesNew ones why are they diffrent??
1 likeThis is the funniest video ever i laugh so many time 😂😂💀
3 likesSML Idea: The time portal!
10 likesJunior has a bad day and then Cody makes a time portal but junior goes in it back to the morning and has to relive all the bad things.
Replies (4)
lets see how many people would subscribe to me after seeing this comment Current--(207) You can help raise that number by subscribing to my channel
0 likes@MrMajestic umm
0 likesI had an idea mr Goodman jumps off a cliff
0 likesH
0 likesfrosted flakes
0 likes19:3
0 likesYo sml I've got and video idea can y'all make Jeffy the bully
3 likesAre those real slogans😯😯😯
0 likes5:21 I like it how you lost character but just kept it in there😂
30 likesReplies (4)
Exactly
1 likeLOL IKR
3 likesYou're from tiktok
1 like@breedyhuliunicorn yliany Have you seen me on Tik Tok?
1 likeAnd why is he Nowhere?
0 likesCody: Gets something legit for once.
26 likesBrooklyn: "Not today!"
Replies (4)
@Ì Àm Ķēvïn BB STOP!!!
1 likeHello everyone! I'm sorry for Self Promoting but I'm fixing to have Surgery and it would be nice if you all helped me hit 10k ❤️
0 likes@IanKava fuck off obvi faker
0 likes@IanKava get an actual life instead of begging for subs
1 likeMC DONOLDS?????????????
0 likesBruh when they where eating the cookie chiropractor Joseph over here going revere cookie chirso
14 likesReplies (1)
Duck
0 likes6:39 I'm a cookie crisp now those lyrics just hit different like 🤣😭🤣😭🤣😭🤣😭💀
33 likesReplies (4)
Yea 🤣🤣
1 likeI liked “Cookie Crisp. You’re in good hands.” 🍪 🥣 🤲🏻 🚙
0 likesThey really dont
0 likesI liked cookie crisp cookie crisp ba ba ba ba ba I'm cookie crisp
1 likeExactly
0 likesDo a video of Mario actually paying his house bill
4 likes😳😳😳
0 likesSomeone did a great job with the songs beat.
4 likesI thought jofus was born how did he know from ba ba ba ba ba kurki Chris
0 likesCOOKIE
1 likeTrue
0 likestrue
7:05 wha- allstate
0 likesHonestly, I wasn’t sure about how well a 20 minute video on Cookie Crisp would do. But it was actually pretty funny.
117 likesReplies (10)
lets see how many people would subscribe to me after seeing this comment Current--(207) You can help raise that number by subscribing to my channel
0 likesHaha me too
1 likeThey're running out of ideas
2 likeshttps://youtu.be/yazne6gVz7I
0 likesI have never laughed at one of the sml videos
0 likes@iFedorasXD u kinda right
0 likes@pro shooters u must be late then just go watch bowser Jr’s playtime 1-6 all hilarious
0 likes@MrMajestic shut up self promoter
0 likes@MrMajestic shut up self promoter
0 likes@MrMajestic are you a bot
0 likesMy sister likes front loops
0 likesjosepht is the coolest jr is the dumest and cody is the smarest
0 likesJesus Christ is my lord and savior
0 likesand the mext lesson is TO NOT HIT SOMEONE I8N THE HEAD WITH A HAMMER
0 likesI would never eat that vegetable trash I rather eat dirt
0 likesCookie crisp cookies can cookie cricket cricket cricket capybara
0 likesPizza
1 like2:21
2 likesReplies (1)
yes
0 likescookie
0 likesJesus loves you
0 likesFrosted flakes
0 likeswhat's funny is that i lost my last tooth on this vid ( I may have 1 more but think it's my last
0 likesYo Logan when u hit 10 million on SuperMarioLogan are u gonna unbox the diamond play button on this channel?
15 likesReplies (6)
https://youtu.be/VVSxuJRu-Q0
0 likesSuperMarioLogan has died as a channel
0 likesThey won't be posting on it
@DimSum ik but it’s getting super close to 10 million
0 likes@DimSum can you really call 4.9 Million subs and millions of views a "Dead channel?"
0 likeshttps://youtu.be/eWk_y0WbLKw
@GOLD DIGGIN' BOI lol ikr
0 likesThey are literally never going to upload on the channel again
0 likes"if colors can get awrong then the companies can get along" -junior
1 likem&m sue skittles
0 likesYou guys make a lot of mess making these videos
0 likesWhy didn't the police officer let junior have ps5
0 likesSML IDEA: Bowser Junior Finally get a girlfriend
3 likesCody was saying gay things if you didn’t hear it you need to get your eyesight checked and good bike like 1 million PS five
0 likesPorterSSSS
0 likesJesus loves you
0 likesYou Didn't go to Cody's house
0 likesyou won't believe How fast I clicked on this video
4 likesReplies (1)
same i was like GOTTA GO FAST
1 likeGodblessLOVESvevo
0 likesNo no dad singles break H Grant PS4
0 likeshow did joseph get a spoon if he is broke??????
0 likesReplies (1)
He isn’t broke sml made a video where he was rich
0 likesMines favorite cereal is yo mama oo
0 likesSML idea: bowser jr. has to have a baby sitter, and his dad gets in a car crash with chef pee pee and the baby sitter tells him the bad news and he has a mental break down and he tell his friends
22 likesReplies (1)
so kinda bowser junior the babysitter in reverse?
0 likesHeyy why you hate on brocile
0 likesWe all know I was right with my choice of making him eat vegetables
2 likesReplies (1)
Yeah
0 likesI like how Cody thinks lucky charms and Cocoa Puffs and trix are copyright slogans when those cereals are the same company
8 likesPov: me having my phone out with the flashlight on while they where singing
0 likesSml that was amazing song reminds me of the lamp sml but I am always eating the cereal when watching this bro
1 like1:42 imagine the starving kids out there watching this … lol
0 likesHow did Brooklyn guy know Cody got the PS5 in the first place?
0 likesDamn, this world is cruel. Junior can’t just follow his dreams and get diabetes without being judged.
7 likesReplies (1)
ikr XD
1 likeI am so happy this account is still open
0 likes16:33 this reminds me of a kill the king flash game
0 likesGuy's im actually I have playstation 5 on my house
0 likesI love your videos
1 likeI’d take those veggies 🤔
0 likesSml = happiness
0 likesBruh this is all the places that Joseph stole from lol
1 likeHere's a catchphrase, Crunch The Crisp Of Cookies
0 likes2:21 joseph had too many sugar
0 likesDID U JUST HIT MY SON WITH A HAMMER?!!!
0 likesI woke up and I farted so hard I fall asleep 😴
0 likesI love your youtube channel
0 likes7:09
2 likesJunior: me
Cody: my friends
Junior: a village, I’m gonna rob it
Cody : no no no no no no no
Why did the cop say he was going to juniors house when he went to Cody’s
7 likesReplies (1)
What?
0 likesi LOVE THE SONG
0 likesAh yes a Kay-da-dilla
0 likescan I get the ps5 for me boys
1 likeOnly SML og's can Sing The full cookie crisp song
0 likes5:38 to 7:34 is a great song
0 likesLol this video is amazing
0 likesCrisp those cookies!
0 likesbruh mid way eating cereal it asked "whats ur favorite cereal?"
2 likes2:17
0 likesCody- peh peh peh peh ahh spank it
0 likes😂😂😂😂😂😂😂
there sold out
0 likesI think itd be interesting if someone made a citizens arrest in an episode
0 likesI wish I had a PS five
0 likes3:00
0 likes2:20
0 likes2:20
0 likesI like how he said ron
1 likeWell again
0 likeswhat what 6:43
0 likesI like how jr stole company’s while singing
4 likesI can’t imagine how much does it
0 likesWait that McDonald's Alexandre
0 likesCOOKIE 🍪🍪🍪🍪🍪🍪🍪🍪🍪🍪🍪🍪🍪 XD
0 likesall of the videos in this channel or all of the SML channels are nostalgia videos
0 likesonly ogs remeber mama luigi
0 likesif you miss the old puppets like this
0 likesHahaha hahaha
0 likesthis is so funny lol im rolling ont the forlle arn ahauihaybsdihahahjahsdbjhabshaha
0 likessml is the best youtuber]
0 likesMy favorite meal is food
0 likes😂😂😂😂😂
0 likesCookie crips
0 likes12:26 Tyrone: Ah it's a cop!
10 likesGoodmans a thief
0 likesWho else was eating cookie crisp well watching this
0 likesCookie Monster: Same kid... Same...
1 likeHow to become juniors dad: 1:43
1 like5:44 you ganna make a ten hour loop
0 likesI love your video’s 😝👍
1 likeI got a slogon It's to die fooooooooooooooooooooor
0 likesI have the same fridge
2 likesJunior and Cody’s cereal
1 likeI live in the UK so my favourite cereal is cookie bite
0 likesJr Cookie Crisp 🍪 and the other one in his heart and has a cookie 🍪
0 likesThis is my idea for a video one day.there should be a cookie crisp vs tricks and junior likes cookie crisp but Cody likes tricks then they have a big argument about there cereal then they try to tell each other that there cereal is better then they agree to eat each other’s cereal to see how’s cereal then Cody eats cookie crisp and he likes it then junior eats tricks then he likes it then junior and Cody are friends again.so that’s my idea and I hope you read this Logan and I love your video’s l won’t to se this video in the future please 😊😊😊
1 likeWhat
0 likes“I held the camera.”
14 likes“You did like 1% of effort”
Me:camera man is ultimate
go around hitting people lol
0 likesLol
0 likesLol
0 likesl love your
0 likesit was satisfying to see junior get hit my a hammer. (i was waiting for this moment my whole life)
3 likesThe cookie crisp/Fast food song
0 likesFunny how I got a subway add
0 likesThe first vegetables in the scene actually pretty good
3 likesHow does Cody know all these brands dude I was like whatttttt
0 likes5:39 cookie crisp song
0 likesNgl that song was fyee🔥🔥
0 likesI like how chef pee pee is becoming a father figure
5 likesReplies (1)
Yass
0 likesThe end is JUST so fuckin funny 19:03
0 likesThey made a song with 40 commercials💀
0 likesIm a cookie crisp now huggies that's not huggies it's pull ups
0 likes5:21 LMAO
0 likesLying is sin repent
0 likesMy discovery of this Chanel Was Amazing
0 likesmy fav cereal is my own cereal called murry-o-munch i made my self
1 likeCOOOOKIE CRISP!!!
20 likessmashes head onto the bowl aggressively
Replies (1)
2:20 yes 😂
1 likeLove you guys so much for the vidos
0 likes#cookiecrisp
0 likesOnly the ogs remember the Pokémon series
0 likesThe vegetables look a little good because it has him that I cooked
0 likesIf you're looking for the boogeyman go find Michael Myers because he's the boogeyman
0 likesMy fav serial is cinnamon crunch
0 likeshajhhbjahbaswd thuosdaiwjhd aspjasd feqipauhfnny
0 likesjoseph: COOKIE CRISPS starts eating like a really hungry dog
0 likesReplies (1)
or a wood pecker dogs eat also like that
0 likesWhy is all the plushies turning into puppets into each damn thumbnails?!
0 likes“Coooookie criiiiiissp, coooookie criiiisp, badabababup I’m Cookie Crisp”😭😭😭🔥🔥🔥
6 likesLogan:junior
0 likesPablo:cody,Brooklyn guy,judith
Lovell:jospeh,Chef peepee,tyrone
Lance:Mr goodman
Elaina:karen
16:35 holding back
0 likesDo you want to cookie because she eat in the room and make a mess😂😂😂😂🤣😂😂😂😂😂
0 likesMy favorite cereal is trix
0 likesBrowser Jr: But Chef Pepe, I Want To Eat Cookies Crip For Breakfast Please?
0 likesChef Pepe: No Browser Jr, You Have To Eat Vegetables Because It’s Healthy And Good For You So Deal With It! Besides, Cookie Crip Is Bad For Your Health And Make You Fat!
Browser Jr: But Chef Pepe!
Chef Pepe: No Buts! Eat The Vegetables Or I’m Tell Dad You’re Get Grounded!
RIP. The puppet's
0 likesYour gonna confuse alot of people with that jungle
0 likesHe4ijrjjrurufuufimfnfi
0 likesJdiririririrjrjifidiiiiiiiiiiii
Jdudijiiiiiiiiiiiiiiiiiiiiiiiiiijd
Kdkdjdjjdhffybxcxgsgsgxgyxgxgdgdggdyc
didhhdhdgdgdgdgghhxhsysyetregeh3ieudyshsgebbdhdhghgthryydyeyryryryryduudydyduf8fufufuf
frirkrjfjjfhfjfjfjfjfjfiufhrudiduhssyhe
When Karen sing the song I couldn’t even understand what she said
0 likesJeff’s can You sign my autograph
0 likesI like how Joseph just went like CoOkIe CrIsP
2 likesCody deserves it the most he has to deal with jr and Joseph’s bull shit
0 likesReplies (1)
Facts
0 likesFinaly the channles back
0 likesEw I would not eat those vegetables
0 likesUhhh I thought Cody was smart and was gonna love the veggies- I hate veggies and fruit btw-
1 likeLet’s all take fact that Cody is gay but he said dirty girl
0 likesI DON,T WANT VEGETABLES!!!!!!!
0 likesThey made hella money off this video
0 likesHsnchxhduuddufiduudufuruTutututoTitiififitJtitifKTJGUGghjfhthttutujtjtjtjTJTjtjTuththththututututututututuututututututytututututututututututtutuu7tutututututufufufufutututufufututututufutututututuuttuututtuututututuut7t7tut77t7t7t7t7t7t77t7t7t7t7t7t7t7t7t77tututititit75r7476t7uutufufufufuuffuufufufufufuufufufufufufufuufufufufugufuufufufufuguufufufutufuufuguufuufuffuuggugugufuuufufufuguuguguguguguguguguguuguugguugguuvuvuvvufuufuffufufufuufuufufufuufururuir8r8riorir77r7r7rurututuhyt8r7r7r8r9ririififirutthhfjfifototofootororofoofot9
0 likesGoodman took the PS5 because there sold out
0 likesTbh, those vegetables actually look good.
3 likesReplies (1)
To be honest they kinda do
0 likesI feel like he should’ve ate them
Cookie crisp
0 likesObviously seen before Cody can throw hands better than junior he even beat up junior so he is kinda op
0 likesWOW
0 likesITS STILL ALIVE
0 likesWhat about ""the krispiness makes it better"
0 likes6:06 AAAAAAAAAA MY EARS
0 likes18:48 wouldn’t the lesson be don’t plagiarize????
0 likesshout out to everybody who watcht SBL this is sbl
0 likeshow is this still up omg hes not allowed lol
0 likesThanks that's true feelings De
0 likesEven the pizza
0 likesIs the homeless still under the couch
0 likesjunior why do you have to be so mean
0 likesIt's backkk
0 likesI Love you MSL🤟💗
0 likesDalani
CoooKkkkIIIEeee CRiiSppppp
0 likesFroot Loops
0 likesWhy did he kill him and he stole it and he just amid it LMAO You have millions you could buy 1 billions of them
0 likesYour right road manz
0 likes🕳️👄🕳️ my eyes❗
0 likesI was trying to sing the song,
0 likesCould be grasped Cookie Craft tresper McDonald's cuckoo for Cookie Crisp they're magically delicious smiles back the rainbow Chris was there give me your heartbreak give me your breakup. Cookie Crisp
0 likesCookie Crisp nasty
0 likesI will try again tomorrow
0 likesRichard Goodman can you sign my Autograph
0 likes😅😅 I got an ad as soon as junior clicked the remote
3 likesSML Idea: Shrek's Mistake!
6 likes"Cookie 🍪 krisp this is America" 😂😂😂
7 likesReplies (2)
Hello everyone! I'm sorry for Self Promoting but I'm fixing to have Surgery and it would be nice if you all helped me hit 10k 😊
1 likeAt least u anit that bot that said the same thing
0 likes6:10
0 likes"Its not a cookie unless its Crispy"
20 likesTell me if I won
Replies (4)
Sml sml sml am sm l
1 likeRead me name
0 likespls
@White Pencil ?
0 likes@White Pencil oh ok why?
0 likescoco pops
0 likesTHIS SONG IS FIRE ASF🔥
97 likesReplies (9)
Ikr
4 likesLol ikr
2 likesLo key it is
2 likesTrue taht
2 likes1111111111111111111111111111111
3 likesYo
1 likeWhat genre of music is that
0 likesI
0 likesKnow
Right
INR
What song?
0 likesCookie hut
0 likesI love how sml makes videos every 2 days
5 likeswhats werid i got cookie crisps on the same day
0 likesJr: Lets watch some tv while we eat
21 likesYoutube ad plays
Replies (3)
Perfect timing?
3 likes@The3rro3breaker Yeah XD
0 likesThat happened to me
0 likesWhen I was watching a ad from Arby’s said we are the meat 😂
4 likesThis one of the best sml videos in a long time!
17 likes6:29 I felt the soul into it
49 likesReplies (4)
Was Tricks
0 likes𝐂𝐡𝐫𝐢𝐬𝐭 𝐋𝐨𝐯𝐞𝐬 𝐘𝐨𝐮.
0 likes@Brylon Brown 𝐂𝐡𝐫𝐢𝐬𝐭 𝐋𝐨𝐯𝐞𝐬 𝐘𝐨𝐮.
0 likes@led lights he loves him, but not you
1 likeI was sooooo angry wan cop hit jr
0 likesHow did he know the ps5 was at cody's house, didnt he bring it to junior's house
6 likesReplies (1)
I know yo riktok
0 likesI click on the video so fast I did not even see the title.
4 likesI thought that the cop gave the ps5 to junior so why would he got to Cody’s house???
13 likesReplies (3)
Hello everyone! I'm sorry for Self Promoting but I'm fixing to have Surgery and it would be nice if you all helped me hit 10k ❤️
1 like@IanKava uh
0 likesIkr to that's what I was thinking
0 likesMy cereal is stealing companys slogans and selling from lila rossi
0 likesThis was like that time me and two of my friends and other people we had to make wooden drop rides and we put eggs in them so me and my two friends did all the wood frames the walls the mechanisms while the other guys made stuff we weren’t even gonna use and we had to pick lolli sticks to see who would keep it me and my two friends agreed whenever we went to the park we would give it to the next person but the one kid he didn’t do a single spec the other kids did like a tiny bit but the kid who did nothing got the drop ride I went mad and he still has it till this day 2 years ago that was nearly 3 years
3 likespov; DO NOT HIT
0 likes15:40
4 likesyare yare
Did anyone else notice the quick cut in the video at 17:22
3 likes“Junior, do you want diabetes” junior: yes
36 likesReplies (8)
Hello everyone! I'm sorry for Self Promoting but I'm fixing to have Surgery and it would be nice if you all helped me hit 10k ❤️
0 likesHehe..
0 likes@IanKava what are subs gonna do for a surgery??
0 likes@IanKava you a bot?
0 likesSubs give u money and they are a scam
0 likeshttps://youtu.be/l_2Z7iqdqtI
0 likes@Ì Àm Ķēvïn BB Shut up.
0 likes@IanKava why? Are you a bot
0 likessbl idea; the comeback
4 likestbh not sure what to name it but
plot : Junior and Cody get a call from their kids ( chef pee pee's kids ) and they don't know the number, once they answer it they hear the kids' voices and realize, jr & cody talk to their kids, asking how everything's going then Chaz talks about how he got a masters degree in college, and how hunky he is, then starts talking about his gf. Cody gets pissed off and talks about how Chaz was supposed to be gay like his father. (im not very creative tbh, you can add more) Anyway jr jr, talks about how he's a 5-star cook for a rich guy (Mr.Goodman), and talks about how he gets 100 dollars an hour. Then all 4 of them (maybe include joesph) talk about them coming over to their house, and they ask jr jr to make a meal for them, bowser comes down and gets served a bowl as well, jr jr cooks a steak with a side of vegtables and bowser wants jr jr to replace chef pp, and chef pp gets pissed and wants to have a cooking battle with jr jr, chef pp makes his famous old recipe (the bet vid), while jrjr makes bowls of mac n cheese, chef pp calls it too simple then when everyone tries it they love it. Bowser wants jrjr to cook for them, but he denies as he has to cook for goodman, meanwhile cody meets chaz's gf and actually starts to like her
this is all i have im getting so confused writing this, i had a plot 2 but this is gonna take way too long but basically cody, joesph, and jr go outside and see their kids while outside you can make the rest of the plot im so tired
12:10 Small detail, but you forgot to edit in a doorbell sound.
7 likesReplies (1)
Facts.
1 likeInstead of you can’t out Cookie Crisp the hut it should have been you can put cookie the crisp
1 likeReplies (1)
Or just cookie pieces in milk
0 likesThat song was fire as fuck I kept replaying it and my favorite part was “There magically delicious”
27 likesReplies (5)
SAME!
2 likesSA ME!
2 likesSAME!
1 likeSAME!
1 likeSame i loved the there magically delicious
0 likesBrooklyn Guy: The lesson of today is don't steal.
30 likesMe: And the other lesson is don't knock people out with a stupid hammer.
Replies (10)
And he's a police officer I hope he loses all of his fucking jobs🤬🤬🤬🤬🤬🤬
1 like@Meliodas lmao
0 likesLatrice put a super duper sus comment lmao
0 likesIF U SAY THAT BAD WORD AGAIN LOGEN IS GONNA LOSE A SUBSCRIBER CAUSE OF U
0 likes@Meliodas and it will be me
0 likes@ramenynoodley do u have a youtube channel
0 likes@Ovia sritharan ikr
0 likes@Penny Kibler yeah why?
1 likeCause of u tell me I will subscribe
0 likes@Ovia sritharan nigga what did I do
0 likesDude when he says all the slogans it’s nastalgic
37 likesReplies (24)
ur spelling is just absolutely amazing. ur prob like 10.
3 likesnastalgic
1 like@Incognito\ as you say "ur" instead of Your/You're
1 like@Altaïr 😂
0 likes@Incognito\ you're*
1 like@Altaïr i say ur instead of you’re cuz its way easier and faster to type
0 likes@Incognito\ Just make sure you can type words correctly when you try to make fun of someone else's spelling.
1 like@Altaïr i can im just too lazy
0 likes@Altaïr if u read my first reply to u you would know why i wrote ur instead of you’re.
0 likeshttps://youtu.be/O77XlKNsgEI
0 likes99% of y’all won’t see this but I hope you’re having a great day🥰
0 likesI’m a small content creator & make videos & it’s my dream goal to get to 2k of yt friends for my birthday in February❤️
That’d mean alot to me if you can check my channel out☺️❤️
https://youtu.be/O77XlKNsgEI
0 likes@Incognito\ it’s Your anyways.
0 likes@Jumpz your*
0 likes@The How you're is short for you are.
0 likes@Incognito\ yeah but you are making fun of somebody for SPELLING and can't write you're? Grow up 🤣
0 likes@Jumpz what rank are u in rocket league?
0 likes@Incognito\ ah, sich a hypocrite. The thing is i can copy and paste this comment to you and it would have the same effect. 🤣🤦♀️
0 likes@Jumpz ur making no sense rn.
0 likesnostalgic. o btw how is it nostalgic they still play those slogans it isnt something that you have to remember back to
0 likes@Jumpz I know. Your is the correct word to use because “You are spelling is bad” It’s meant to be “Your spelling is bad” because “Your” is when you’re talking about about another person’s things like their spelling. In conclusion, you’re all idiots.
0 likes1:25 I II the game
0 likes1:25 and the other
0 likes@The How you are probably 10. Thats what im talking about
0 likesCookie crisp Cookie Crisp babuhbabuhba on cookie crisp
0 likesJr: Why don't we call ours cookie crisp hut? "
26 likesJoeseph: OOOOOOOH
Replies (2)
*Joseph
2 likes@imsad oh ye thx
0 likes0:17 the noise Logan makes when he sees Chili's channel
45 likesReplies (11)
Probably true
1 likeLol
1 likeHaha lmao
1 likeFalse
1 like@Seanbad Meippen They arnt
1 likeFacts
1 likeImao
1 likeLol
1 like@Seanbad Meippen they are
1 like@GCBlitz hellllllllllo
1 like@Redjaythechamp they are
1 likel hate green beans
0 likesgood job promoting lgbtq "facepalms"
0 likesI love how Junior goes out of his way to reference copyrighted slogans.
147 likesReplies (27)
https://youtu.be/eWk_y0WbLKw
0 likesH seed kg
0 likes@Nintendo_RBLX 2 stfu
4 likesHehe...
0 likes@Nintendo_RBLX 2 ur lying because I seen that comment on alot of his videos
1 likeHello everyone! I'm sorry for Self Promoting but I'm fixing to have Surgery and it would be nice if you all helped me hit 10k ❤️
0 likes@Nintendo_RBLX 2 you fucking just post that on a other comment
0 likes@Aidynpennywise🤡 what is it??¿¿
0 likesJunior is stealing slogans from companies so they will be sued
0 likesThis is the humour I love from logan
0 likes@Nintendo_RBLX 2 nintendo roblox 🥶🥶🥶🥶
0 likes@IanKava your banner says AlienZGamer, so that story is incredibly hard to believe. Not only that, but I’ve seen many comments like yours from different channels. And also, what will subscribing to you do? That only gives you dead subs, which is terrible for the algorithm. If you need subs that badly, try this concept called making videos that people can watch without dousing themselves with gasoline. Quit your bullshit.
0 likes@IanKava 10k subscribers won't fucking help you get surgery
0 likes@Kojo Amoako love how you censor it
0 likesHu
0 likes@Nintendo_RBLX 2 Liar Liar Pants on fire!
0 likes@IanKava NO!!!
0 likesDo u mean copyrighted Logan's 👏🥁
0 likes@Oscar Marke my mom had surgery yesterday
0 likes@GOLD DIGGIN' BOI well well well hello self promoter
0 likes@Nintendo_RBLX 2 what did he say
0 likeshttps://www.youtube.com/watch?v=iWfOTbaufqQ
0 likes@IanKava fuck off self promoter go to hell faker
0 likes@GOLD DIGGIN' BOI I thought you stopped self promoting oh well good lier you are
0 likes@IanKava why do you need subs?
0 likes@Giovanny1269 That's so interesting! Tell me more.
0 likes@Ì Àm Ķēvïn BB I DON'T CARE ABOUT ALL OF THAT RUBBISH
0 likesJunior: I am a Cookie Crisp now Cody: wait HUGGIES😂
52 likesReplies (14)
Cool
2 likes@Bruhfreecs 🤡
0 likeslol
0 likesMy favorite part is 7:05
3 likesJunior: “Cookie Crisp. You’re in good hands.”
Cody: “Allstate?!?!?”
@displa1FN imagine using clown emoji 🤡
0 likesHe meant Pull-Ups
3 likes@Coben nole imagine 🤡
0 likes@Christian The Thomas And Friends Fan ALT Extra 2 Pull-Ups are owned by Huggies.
2 likes@displa1FN ikr 🤡
1 like@Coben nole yea dude 🤡
1 like@Black Kitty lol
0 likesThat is pull ups actually
0 likes@Coben nole 🤡🤡🤡🤡🤡🤡🤡👾
0 likes6:39
1 likeLet's all just think about how much money they would've had to pay since they used 17 slogans in the song
3 likesSML MOVIE PLOT:
7 likesJunior and his friends want to eat Cookie Crisp for breakfast, but Chef Pee Pee doesn’t let them in the goal of turning them healthy
Last time well see this junior 😥
4 likesI haven’t watched SML in like 6 months and it was my favourite YouTube channel for like 3 years and to be honest I’m glad to be back watching it
9 likesReplies (7)
Didn't ask cuh
0 likes@Just Slayer i did
0 likes@Kayla where is your comment, oh wait...
0 likes@Just SlayerFirst of all if you didn't ask then why did you reply and second of all why you calling me cuh bro stop trynna act hard
0 likes@Inter Zone Niggggggaaaa
0 likes@Just Slayer sit down bitch you aint black
0 likes@Inter Zone Nigga
0 likesNo I feel bad from me playing my vr headset I missed this I was playing it for a hour
3 likesReplies (1)
Wow that's a record great job.
2 likesMan i would love to see jr puts on a kane mask and jest like the movie mask except the funny part jest jr fights his friends and family👍👍
Jeffy!!!!!!!!!!!!!!!!!!!!!!$$$$$$$$$#$$$$$$$!!!!!!!!!!!!!@
1 like🙀🙀🙀🙀🙀🙀🙀🙀🙀🙀🙀🙀
0 likesHow did Brooklyn know the ps5 was at codys house if he brought it to juniors?
3 likes5:39
27 likesJunior: "Hey Cody?"
Cody: "Yeah?"
Junior: "Let me tell you about the best mother freaking cereal you can buy"
Me: LMAOOO!!!!
Replies (7)
Not funny 😑
1 likeThe Legendary Gamer WOOOOOWWWW u found the real logan
1 likeMabey u could win awww wait never mind brooklyn might just take away ur new console
@Kajus Jacky shut up.....................nah look I'm just playing ahhhahahahhhhh I always play
0 likesYES IT IS
0 likes😂😂😂😂😂😂😂
0 likesThey stole a lot of companies like Bing thing they just like a lot of stuff from a neighbor took the Bubba Bubba Bubba from McDonald’s they took the Pizza Hut they took subway thanks a lot of stuff equipment company
0 likesThey stole a lot of companies like Bing thing they just like a lot of stuff from a neighbor took the Bubba Bubba Bubba from McDonald’s they took the Pizza Hut they took subway thanks a lot of stuff equipment company company
0 likes0:69
0 likesMe: throw the vegetables at my sister and my sister lock out me: get the candy
20 likesYo Logan can we get the chef pee pee goes crazy SML Movie: where chef pee pee goes crazy after working for bowser for a long time and he turns into turtle soup
4 likesOnly og’s remember when junior wished for all the food to be Cookie Crisp
2842 likesReplies (500)
I was just watching that episode
73 likesFacts XD.
43 likesAs that in 2018 or 2019 I don't remember
29 likesHehe
12 likesYeah same
9 likesI’m an og
23 likesI’m sure all of us know by now. 🤔
28 likesits not og tho
90 likesremembered it once i saw rhis
3 likesI remember
7 likesThe good old days
8 likesFacts
3 likesThat’s not OG like at all
34 likes@smart monkey 2018😂
4 likesTo The Early Squad Reading this: Sending Virtual Hugs to everyone who need it always stay safe Read my name 💓
6 likes@I Am KevinBB bruh
5 likesThought this was this episode
2 likesThat isn’t og
17 likesI do
1 likeYup it was funny
2 likesGood times
0 likesYeah that was one of my fav vids
1 likeYep Me
0 likes💯
0 likesOgs yeah sure only ogs remember when Joseph gave junior goo from under the sink
12 likesI remember
0 likesWho dose not if you do not watch you can't watch any sml
0 likesNah I remember wayyy more of vida than that boi
3 likesMe
0 likesOmg on his last wish he did not being back joesh from vein stuipd rich🤐
0 likesOnly ogs remember junior going to Disney world
2 likesYh I would always watch it
0 likesIt wasn’t that long ago
5 likesThat’s not OG but cool u remember tho
Facts
0 likesYep
0 likes60 likes in 2 minutes😳
0 likesI'm an oh boyz
0 likesYa
0 likesSml movie: the lamp
1 likeCount me in
0 likesBarely og
2 likesI remember
0 likesThat isn't og lol. What is og is when woody was used when Junior wasn't a thing when mlsda was good.
5 likesI loved that video
0 likesIk
0 likesHow many subs can I get from this comment
0 likesCurrent: 1- oh wait I am not a bot
yes sir
0 likesThat doesn't mean you an og
1 likeI remember!
0 likesFacts I remember and it was so funny but stupid
0 likesThat was 1 year ago so what do you mean “og’s”
4 likesCody was having a good time with his wish 😏
0 likesNot OG
3 likesFAXX
0 likes✨Facts✨
0 likesY e s
0 likesAnd everybody was gay
1 like@IanKava no
0 likesWas just abt to say dat
0 likesI remembered that LMAO
0 likesFacts
0 likesI’m a real og I was here in 2014
1 likeAnd cody wished everybody to be gay and Joseph to be dumb Rich
0 likesYeah with the map
0 likesBruh that’s not og I remember Mario and Luigis stupid and dumb edventures
2 likesI was just bout to comment that 😂
0 likesIt was only a year ago.
1 likeWE KNOW LMAO
0 likesI watched it
0 likesIn the lamp
0 likesThat was like 2 years ago. That really isn't og. Og is like 6 or 7 years ago
1 likeCody’s wish...
0 likesYep
0 likesYeah I still remember it
0 likesThat was like a year ago I've been here since the stupid crazy adventures
0 likesThat is not that long
2 likesIt’s not OG because it was in 2019 or 2020
1 likeI was just thinking of that the minute I saw the name of the video.
0 likesBruh that was a year ago
0 likesI remember
0 likesOgs that was only a couple years ago
0 likesThat's being og is when they recorded in Logan mom's house
0 likesAnd josef to be stupid rich
1 likeThat's not og
0 likesOG squad
0 likesNo only ogs remember bowser juniors game night 1
0 likesNo only ogs remember when junior became a coffee adict
0 likesI do
0 likesThe lamp was a good video
0 likesWhen i saw this video the first thing i thought about was that episode lol
0 likesI’m not an OG and I’ve watched it
0 likesYe I was just watching that
0 likesLol i do if was funny tho
0 likesIm an OG :)
0 likesI miss that
0 likesI remember lol
0 likesLol i do
0 likesThat doesn't mean you an og and plus that was either two or one years ago
0 likesWhos ur favorite sml character
0 likesIkr
1 like@Ab junior, chef pee pee cody joseph and jeffy
0 likesSo true
0 likesOnly Ogs will remember when Patrick and Felipe starred in a cookie crisp commercial
0 likesIts only like 2 years old
0 likesI remember that
0 likesNo ogs
0 likesI remember that and I started watching 4 years ago
0 likesThat’s not og
0 likesYes I remember
0 likesI'm such a big fan
0 likesI'm such a big fan
0 likesI remember the good old days 😭
0 likesThat video came out a year or two ago that's not being an og
0 likesi reember
1 likeI remember that
0 likesNo because that was only 1 year ago
0 likesThen Cody wanted everybody to be gay
0 likesI remember lol
0 likesNo only ops remember juinors happy meal 1
0 likesOnly og’s remember Patrick and Filipe’s heart disease Cookie Crisp commercial
0 likesIt was only 2 years ago
0 likesOnly ogs remember a time before jeffy only ogs remember mama Luigi and his characters
0 likesI remember that one and Cody wish everyone was gay and Joseph wished to be stupid rich
0 likesIn the lamp I remember
0 likesI rennet that
0 likesikr lol https://www.youtube.com/watch?v=iWfOTbaufqQ
0 likesTHATS NOT OG IDIOT
1 like@smart monkey 2019
0 likesI remember
0 likesI'm an og iv been watching sml since 2014
0 likesOnly go’s will remember Kirby and Mario
0 likesThat wasn’t even that long ago if you remember when black yoshi turned Mario into a gangster then that’s og
0 likesThat was like 1 year ago not really og 😂
1 likeI do
0 likes@Frxzens Joseph’s house : )
0 likesThat was a grate video remember the pizza they order
0 likesYup it's my favorite sml vid but how did they not get sued
0 likesThe Real OGS remember when Logan used his Mario Wing Cap Plush to Show His Cats,Videogames,Nintendo Merchindise,Shrimpo Hunter,Toad Rap Song,MLSDA,Mama Luigi And Tony The Tiger
0 likesDamn I can’t believe that was a year ago
0 likeshttps://youtu.be/aNOI2v5izN8
0 likesYa
0 likesFax
0 likesThat was three years ago calm down
0 likesAnd cody wanted everyone to be gay😭😭
0 likesI remember when that video came out
0 likesI remember that
0 likesYup
0 likesHell yeah
0 likesAll fax no printer
0 likesIts not really OG
0 likesYeah I do
0 likesU sound sassy be saying that
0 likes@tepig 4 life ikr
0 likesReal ogs go back to 2016
0 likesSwear
0 likesI know that episode lol
0 likesFam it was literally 1/2 of a year ago
0 likesOnly OG’s remember when mama luigi was a character
0 likesI remember
0 likesThey found the dragon balls
0 likesOh ya him
0 likesI remember the
0 likesBro that was like 5 months ago your not a real OG 💀
0 likesIt’s not that old of a vid..
0 likesDon't get mad at me I didn't put the comment
0 likesLol it was amazing
0 likesI missed these long episodes
0 likesI remember
0 likesLowkey not og tbh
0 likesYes
0 likesThat’s me
0 likesOnly go’s remember that Logan put Root beer on Cookie Crisp on that one super ball episode.
0 likesStfu only ogs remember the pokemon series
0 likesI'm a og cus that video was. Not that og if your a og you need to remember bowser jrs happy meal and bowser jr goes to the circuses
0 likesI remember
0 likesnope og fans will remember jeffy gets bullied or mario and Luigi stupid dumb adventures
0 likes@Bolle _ stfu, only og’s remember the super stupid Mario adventure series.
0 likesBruh am not a og i watcged them 4 years
0 likes@Bolle _ the Pokemon series was lit but they aren't gonna finish it
0 likesThat was only like a year ago lmao that ain't og
1 likeThat’s 100% not og
1 like@TTV Tllntll I remember that
0 likesFacts
0 likesHow can I not remember that
0 likes@Giga chad okay so I’m good
0 likesYep
1 likeI remember.. it was in the treasure map video
0 likesI watched every single episode
0 likesNot too og
0 likesMe
0 likesthats not og thats the same channel :/
0 likesGood times
0 likesMhm
0 likesWut
0 likesThat ain’t even og
0 likesi remember that video the lamp
0 likesTrue
0 likes@Official vegito IKR they’re like 10 yr old that think its fortnite
0 likesThat isnt OG lmao
0 likes@the random channel 2018 so kinda of og
0 likesBruh that was only 1 or 2 years ago
0 likesOmg I remember that
0 likesOgs are the ones who watched when he filmed at his moms house
0 likes@smart monkey 2019 :)
0 likesYeah cody made everyone gay as him
0 likes@smart monkey WHAT
0 likesThats notbog
0 likesAyyy, cody got the cookie crisp
0 likesThe lamp
0 likesFacts
0 likesthat weren’t og
0 likesFax
0 likesI Am KevinBB u just want views
0 likesAnd Cody wanted every body else was gay
0 likesYessir
1 likeDo you remember the summer school episodes bc the Cookie crisps was kinda new and the summer school but that was really fun to watch
0 likesOh yeah 😄 and everyone was Gay.
0 likes@Official vegito true
0 likesI do
0 likes@Oliver Perry yeah
0 likesFk
0 likesI watch it I can prove it Joseph wanted to be stupid rich Cody wanted everyone to be gay junior wanted every food in the world to be Cookie crisp
0 likesOh yeah I forgot about that
0 likesThe Lamp
0 likesYeah
0 likesI love that episode
0 likeskinda but that wasn’t posted that long ago
0 likesI loved that episode
0 likesThat was a good video
0 likesIm og btw
0 likesOriginal gamers
0 likesSame
0 likesHow is that an og?? Surely it would be in the old house if your an original watcher.. this is what went wrong with super mario Logan.. he was pretty much forced to become a more like kids channel.. and now has a kid fanbase..
0 likesIt's not og but yeah I remember the video
0 likesikr
0 likesI watched that video 50 times because its that funny
0 likesYesssir
0 likesIts not og
0 likes@smart monkey it was this year its not og
0 likesI remember that episode
0 likesI’ve been watching SML since 2915 I think
0 likesThe magic pot?
0 likesI do
0 likesOnly ogs remember black yo shii and the birds
0 likes@Truegr fuck no the good ol days was black yoshi and the birds
0 likesI remember it
0 likesI remember that so me og
0 likes@smart monkey 2019
0 likesNah only ogs Remeber when junior was addicted to coffee
0 likesThat video wasn't to long ago
0 likesI remeber that and Joseph wished me was stupied rich
0 likes@Megachin I remember that I'm og boi
0 likesI know that episode. "The Lamp"
0 likesI remember
0 likesI started watching them when “ jefffys parents” came out because it kept coming up in my recommendations in every video I watched. I regret nothing
0 likesYeah
0 likesOh yeah the ginnie map
0 likesOh yeha
0 likesDude is was like last year
0 likesWasn’t that many years ago
0 likesI do
1 likeTrue OG’s remember what 2+2 is
0 likesit was the dumbest wish
0 likesI remember
0 likesThat wasn’t long ago I think it’s. This channel so it’s not og
0 likesThe lamp
0 likes@Tyborge_410 baby 2
1 likeLol fax’s
0 likesOnly OG’s remember what 8-4 is
0 likesGood old days
0 likesYup
0 likesYup it was the lamp
0 likesHe thought that pizza was going to be pizza nope
0 likesOG’s? Wasn’t that episode a year and half ago in 2019. Or is this a different episode you’re talking about and I’m not a real OG so I don’t get the reference.
0 likesYep I thought before I clicked the vid if there is going to be only cookie crisp
0 likesYea I no
0 likesThat literally 1year ago that's not long enough to be an og what about 3 wishes that was a while back in the house before the apartment
1 likeI watched it i liked the video it was good
0 likesI thought that’s what this was when I clicked it 😆
0 likes@smart monkey same I think 2020 actually
0 likesOnly actaull ogs remember the cookie crisp commercial
0 likesThat wasn’t og, og is 2014 or below
0 likesOmg yes
0 likesI do
0 likesSML Movie: The Lamp
0 likesYes sir
0 likesYup
0 likesYes the title of the video is The Lamp.
0 likesI remember
0 likesThat wasn’t a og video
0 likesYUUUUHH AND BROOKLYN WAS THE Genie
1 likeThe Lamp
0 likesAnd when everyone turned gay from cody
0 likeswish
Not rlly XD that’s not at all being a “og” they have been doing videos for about 5 years that episode only came out probably like a year ago
0 likesOg= koopas new job
0 likesOg= koopas new job
0 likesYour not og
0 likesThe lamp
0 likesi remember that but that’s not og lmao 😂
0 likesAYYYYYOOOOOOOO
0 likesOgs? That was only like 3 years ago.
0 likesThat wasn’t too long ago that was like 2/3 years ago not that long
0 likesLove that
0 likesYes
0 likesFax🤣
0 likesI remember lol
0 likesThat's not og
0 likesIts like saying ur og cause you played in season 4
0 likesOnly og's remember when it came out last year
0 likesYup only og's
0 likesI do
0 likesOnly ogs know bbbaby machine
0 likesThat’s not even that old
0 likesThat wasn’t even that long ago it was like 2 years ago
0 likesOng
0 likesI’m a og
0 likesYessss
0 likesWhen cody said everyone be gay
0 likesOnly og's remember when sherk had a baby
0 likesI did
1 likeVideo was og
0 likesThat video wasn’t og
0 likesDude anybody could go back to that video
0 likesYea
0 likesYessir
0 likesYea and Cody wanted everyone to be gay 😂
0 likesI remember tht the genie thing when Cody wish for the whole world to be gay as him hahaha
0 likesOh yea in the lamp vid
0 likesThat ain’t og but ok
1 likelol meber that
0 likesBruh thats not og
0 likesSo true
0 likesFr
0 likes@smart monkey no 2020
0 likeshttps://www.youtube.com/watch?v=dvJgbYUQt-c
0 likesYeah in the lamp video
0 likesThen cody made everyone gay but video was not that old
0 likesBest fun fact because one OG what are you
0 likesYes
0 likesThat’s not that og ogs remeber when Cheif Pp ran over a dog or when junior and Cody went to the carnival
0 likesYes
0 likes@I Am KevinBBare you on drugs
0 likesI remember that
0 likesYup
0 likesI do
0 likesYUUUP
0 likesIkr and cody wished for everyone to be gay 😷
0 likesI remember watching that
0 likesYeah true
0 likesAnd the lamp
0 likesTrue
0 likesIt's not og no where near
0 likesI am a og
0 likesOmg yass
0 likes@Official vegito Og is when you started watching when they were in the old house or the apartment
0 likesI thought he reposted the vid
0 likesSo I’m a og and this comment is true
0 likesYooooooo my guy cody wished for everyone to be as g a y as him
0 likesWell im a OG
0 likes@smart monkey 2019
0 likesThat was a year ago.
0 likesYear
0 likesMe
0 likesBrother I remember
0 likesyep
0 likesYup
0 likesYeah
0 likesThat’s was in 2020 🤦♂️ only og’s remember the home alone episode
0 likesGuess I'm an og
0 likesYou right
0 likesThe Lamp in sll
1 likeDude it was only 1 year ago
0 likesThat was like hella new like only on year old
0 likesThe Lamp
0 likesThat was only a year ago thats not og 😐
0 likesOnly ogs remember og cheif poo poo
0 likesIn the magic lamp
0 likesI loky thought it was a repo
0 likesonly og remember the first word ever said on sml was come
0 likesOne yea and when Cody wanted everybody to be gay 😂
0 likesAll bran thats gross
0 likesLol
0 likesOh yeha
0 likesThat’s not og lmao. True OG’s remember Juniors Macaroni & Cheeae :)
1 like@I Am KevinBB ok nerd
0 likesNo shit
0 likesYa the good times 😭😭
0 likesThat video came out a year ago it’s not really a og
0 likesPeepeee
0 likesYeah
0 likes@kayy same
0 likes@Mayar Abdulmajeed wdym it came out a year ago
0 likesThat video was in superMarioLogan so which means it’s old
@kayy that was 1 year ago
0 likesOng
0 likesI remember when it first came out
0 likes@Oliver Perry ur not an oh thrn
0 likes@I Am KevinBB nah my vids are more shitty
0 likesi remember
0 likesTHE LAMP
0 likesThat episode was funny af
0 likesi watched it
0 likesThat was 2019 og are people that watch the old old episodes so your not a og
0 likesYup
0 likesAnd he was gay
0 likesye
0 likesAnd Cody’s wish
0 likesI remembered that!!!
0 likesThe lamp was actually good
0 likesYea I remember that
0 likesI dont think that that was that long ago
0 likesI DO Joseph wish to be stupid rich
0 likesOnyl ogs remember doofy the dragon
0 likesYe I remember
0 likesI remember
0 likesBeing a "OG" is longer then that
0 likesI seen that 2 year ago lol
0 likesSame
0 likesI remember that lol
0 likesI watched that episode
0 likesThat's real FAX
0 likesI watched all the eps they made and Charlie d almosts beat them😭😭
0 likesI remember it was in the video the magic lamp or something like that
0 likes@I Am KevinBB stop trying to get views
0 likesthats not og that episode was on sll
0 likesLmao it was so funny that part 😂😂😂😂😂😂😂😂
0 likes@Electric Cat i know
0 likesDo y’all remember bowsers milk shake?
0 likesThat was like a year and a half ago that ain’t og 😂
1 likeFacts
0 likesIt’s not even that og it was like 3 months ago
0 likesYeah
0 likesAll of the subscribers all ready watch it probably
0 likesAnd I was about to watch that
0 likesI did
0 likesYup
0 likesAnd Cody wishing to all be g@y
0 likesLol bro you ain't no fuckin og that was 1 year ago you a og if you remember the mario adventures in his first ever videos
0 likesWhen the cookie crisps where grapes 🤣🤣
0 likesYep I remember that in the magical lamp
0 likes@kayy same
0 likesIt more og if you remember the old cookie crisp commercial sml did with Patrick
0 likesI know
0 likesI remember when cody turns people gay
0 likesOh yeah the one with the map in the box of cookie crisp 🌰
0 likesI watched it when it came out and it was the genie vid
0 likesLOL ya I remember
0 likes@kayy that’s not even that og
0 likesYes oga
0 likesOg isn't 2018 an og is back when he made Mario videos back when he had a thousand subscribers that's an OG
0 likesi Loves You’re Chris Chris Song😹
0 likesThat’s not even og
1 likeSrfu
0 likesStfuuuu
0 likesIts not that og
0 likesYep
0 likesFacts
0 likesMario and Luigi dumb and stupid Avengers
0 likesE
0 likesOG
0 likesThat was 1 year ago
0 likesThe lamp
0 likesEven better ogs will remember Philips and Patrick’s cookie crisp commercial
0 likesFacts
0 likesyeah in the lamp video and they almost died getting the lamp
0 likesno only ogs remember Brooklyn guys son
0 likesYes I remembered
0 likesYour an of if you rember when the first Marie and Luigis stupid and dumb adventure I’m a of
0 likesI watched all of their vids
0 likesYep
0 likesThe lamp
0 likes@smart monkey 2011
0 likesThat’s not that old
0 likes@E i also play msm
0 likesthank god that u didn’t edit the comment and say thanks for the likes
0 likesWell I'm a og I remember 😃😃
0 likesFacts
0 likesFACTS
0 likesI remember
0 likes@Dream Zerø yeah
0 likesFr
0 likesthats only 2018..
0 likesThat’s not even close to being OG them moving into the new is more OG than that video
0 likesI know this
0 likesA
0 likesWell yes I watched that
0 likessame only og could that ep
0 likesThats not even “OG” 💀
0 likesYup
0 likesNo only true ogs remember when shrek had a kid
0 likesI am a og
0 likes500 comment😁
0 likesThe original channel was deleted but just cause that don’t mean it’s og
0 likesOh yeah and the genie and that almost d3ed
0 likesAnd Cody wished for everyone to be gay
0 likesThat's was so funny
0 likesI remebet
0 likes😂🦷
0 likes@Frxzens yea from when they went to Joseph trailer
0 likesFr
0 likesOh ye
0 likesI thought y’all said you won’t post your good videos on January, this was great
10 likesReplies (5)
Funny lol
1 like@Christopher Watters you know where I got that From?
1 likeHaha
0 likesYea the videos been kinda trash but this was great
0 likes@BoneAppetit MEH bone apple titty
0 likesI can't believe they didn't get sued in real life
10 likesReplies (3)
They probably had permission to make the song about cookie crisp...
2 likesMakes sense
1 like@Reign Johnson yuh
0 likesHi jeffy
0 likesSml Idea: Kidnapped
38 likesMario tells Bowser & Chef Pee Pee that they have to take Junior & Jeffy somewhere with them, but there's something terrible that might happen.
Replies (12)
Well good I hope it happens to bowser JR.
2 likesThey won’t do that because that video idea is not child friendly
2 likesBut it’s still a good idea but it won’t work
1 like@Anthony Ruiz bruh
2 likesJared Parker I’m not saying it’s just my opinion
1 likeBad idea
0 likes@dat boi marv yea why marvin
0 likesThey already did a kidnapped video
0 likes@meliodas mahn ur just like CODY mahn
1 like@Savag badger 🦡 yeah except im not gay
1 like@meliodas I obviously never 🙄 said u were gay jaysus
1 likeOh wait
Never mind never mind ok yeah u got me there
😢
1 like11:38 Its december now
2 likesfroot loops
0 likesi love they said "im a cookie crisp now" with huggies
34 likesReplies (3)
but is mr goodman the ceo of it???
0 likes@Nick Brewington TRUE
0 likes@Nick Brewington he’s CEO of everything
0 likeswhen cody has the ps5 on his bed logan forgot to add the door bed sound when brooklen guy was trying to take it
5 likes0:56 OMG IT'S VEGETABLES
1 like5:22 Junior:Joseph You’re Gonna... MESSED UP
0 likesCody:LET’S SPANK IT
18 likesEveryone:what.
Cody:i uhh i said lets spit on it
Replies (3)
LOL
0 likesCody is very sus
0 likeswe know🤡
0 likesWhen I look in the window I see a hammerhead shark painting hammerhead sharks are one of the least dangerous sharks
18 likes0:56 omg it’s vegetables
0 likesMe: eating cookie crisps while watching
0 likesJoseph says it didn’t come to me in a dream seconds earlier says it came to him in a dream
1 like18:21
0 likesBa Da Ba Ba Bah I'm suing it.
13:10 I like the fact that they're Jewish but he I think he like lettuce guacamole bacon
0 likesIs so funny When the sing 🤣🤣🤣🤣🤣 👌
1 likeI found old ep that I can’t find on the channel
0 likesi got a grammarly ad when he turned on the tv lol
0 likes2:21 😂😂😂😂 josiph looks like a wood paker
0 likesMy question is why did Juniour not just take the PS5 back to his house?
4 likesOmg I used to say yes when I was asked if I want diabetes lmfao
0 likesThe real question is how did guy know that the ps5 was in cody house
8 likesReplies (2)
Idk
0 likesHmm idk
0 likesSubway: 5$…5$ footlong
1 likePizza Hut: don’t out pizza the hut
Classic commercial lines 🙂
Cody was snitching on them the whole time they were singing
0 likesThey’re magically delicious
2 likesLove Junior song is so fun I love it I always watch it always want to sing that song everyday One night in my bed
0 likes4:36 if colors can get arong then companies can to
0 likes16:51 LMAO
0 likes4:53 if colours can get arong then companies can get along
1 likeI was eating cookie crisps while watching this
3 likesReplies (1)
Same
0 likesIf I made a jingle for Cookie Crisp it would be like “Cookie Crisps , your dessert has finally become breakfast
1 likeIs it just me or did this song go hard!
1 likeMr goodman bought a used ps 5
1 likeI f**king love sml your doing fricking great
0 likesI have cookie crisp yeah I feel like I’m a child but I don’t know what to say LOL
0 likesAre you now it’s just I regular Cheerios they taste really good with milk you got a try them
0 likes1:43 I bet Cody would want to eat it now
0 likeswho is confused that joseph wants it at his trailer when he has no electricity 😗
0 likeswhen was coys mom so mean
0 likesI love how jr Threw the salad at chef Pee pee because salad is boring for breakfast
1 likeBRUH I love it vids!!!!!!!!!!!!!!!!!!!!!
0 likes:0 oh no
1 likewelp i lean someting..
0 likes:)
arby says all our food keep blowing up
0 likesblows up
3:25 is kind of like 2 tickets
0 likesI love when brykloon t guy tries to hit junior with a hammer🤣🤣🤣😂😂😂😂😂😂
4 likesReplies (1)
brykloon lol
0 likesAlternative ending Bowser Jr Walks away with the ps5
0 likesJunior: wow cody, your so selfish and so greedy that you hid the PS5 so you can hide it for yourself
0 likessays the guy who tried to change the rules cause things didn’t go your way
Bro stole the whole country😂🤣😭😭😭😭😭
0 likesFruit loops
0 likesJr: I’m a Cookie Crisp now
11 likesCody: huggies?
Me: that’s pull ups
Replies (2)
The company is Huggies
1 likeI thought that was toys r us
0 likesI was dying after Cody said ewww
1 likeI’m eating Cookie Crisp rn it’s so good 🤤
2 likesReplies (1)
Like your vids
0 likesI love how there’s a good end and the even play with childish puppets and I still watch this
4 likesI did 🤣😁
0 likesI love this
0 likes5:37
0 likesHow does Brooklyn T Guy know jr gave code the PS5 wtf
0 likesthis is so good
0 likes12:25
0 likes2:20
0 likesthe song lowkey fire
0 likes0:16
0 likesA U G H
Froot loops
0 likesomg a ps5
0 likesY didn't they plug in 3 controllers
0 likesThe Brooklyn Guy might be a criminal
0 likesJoesph:COOOKIE CRISP EATS CRASY
0 likesThat penny did not flip perfect they put it stuck in the floor
0 likeswhen i saw the comment why did goodman take the ps5 he could buy millions of them made me mad because i hate goodman i hate scooter the most but i hate goodman second
0 likesHow they not get sued?
0 likesThat was alot of slogans
Why does Junior care about a PS5
0 likesHe already has one
Yes you do as to eat veggies
0 likesThat how Nintendo sued sml
0 likesHow did brooklyn know it was at codys house
0 likesBro you live in Arizona
0 likesgimme that food that looks BUSTINNNN
0 likesjr song is so good i love it so much
0 likesmy favorite cereal is Reeses puffs
0 likesOreo’s
0 likesI love it
0 likesHow many people want to count how many times they say “Cookie Crisp”?
0 likesJust Do It (Nike)
5 likesNew New New New (Cartoon Network)
We are Cookie Crisp (Farmers Insurance)
What Would You Do For a Cookie Crisp (Klondike)
It’s like preschool on TV (Nick Jr.)
Cookie Crisp has rrridges (Ruffles)
Get Cookie Crisp, save less (Walmart)
Open Happiness (Coca-Cola)
What’s In Your Wallet (Capital One)
America Runs on Cookie Crisp (Dunkin’ Donuts)
Cookie Crisp is our Recipe (Wendy’s)
Nobody Better Lay a Finger on my Cookie Crisp (Butterfinger)
I Want My Cookie Crisp (MTV)
Am I missing anything?
Replies (1)
For the Bold (Dorito)
0 likesCookie Crisp, Cookie Crisp! (Little Ceasar's)
Think outside the Crisp (Taco Bail!)
Was it me or did the broccoli look kinda good
0 likesThe song in this is bussin
0 likesSo much copyright
0 likesI love it
Why does Joseph eat like a bird-
0 likesDaddy
0 likesIf we
Mac 7:14
0 likesMy favorite cereal is Cookie crisp
0 likesi love yuor vid
0 likesCody’s right they did get sued
0 likesJesus was crucified , bore our sins in his body, he rose from the dead in 3 days, trust in him and gain eternal life. Without him we are lost..........
0 likesBrooklyn guy delivered ps5 to junior house but how did he know it was in Cody’s house
2 likesReplies (1)
fr
0 likesI have chips ahoy cereal
0 likesMy favorite cereal is lucky charms
0 likesHow did brooklyn guy even go to cody’s house instead of Junior’s house?
0 likesI search up cookie crisp and this is the first thing that pops up
0 likesMy favorite cereal is : corn flakes
0 likesHow are you how to say it's an Arby's I don't know how to spell Arby's
0 likesSo thay throw spit and 🗑️ at pp
0 likesThe channel got deleted
0 likesImagine how many try’s it took to do this scene 10:26
0 likesReplies (1)
They threw it then cut the video then they put the coin like that so it took like a couple scenes.
0 likesMy favorite cereal is cinnamon toast crunch
0 likesJust let goodmen buy Cookie Crisp
0 likesI love the videos
0 likesYou can’t out cookie the crisp
0 likesAm I the only one that ate cookie crisp whilst watching
1 likeI mean really if u think about it they would not get sued cuz the real names of the slogans is being said
0 likesThis a whole song not a jingle 😂😅
0 likesHow does the police officer know that the ps5 is at Cody's house?
2 likesReplies (1)
It's scripted
0 likesHow
0 likesHow
0 likesCaptain crunch
0 likesthis
0 likespov your eating cookie crisp
0 likesHygg
0 likesI just eat it plan like cookies
0 likes13:14 isn’t Cody’s family Jewish? So don’t they not eat bacon? Bruh 😐
0 likesI’d eat those vegetables
0 likeslol
0 likesAsf
0 likesBrooklyn T guy doesn't mention the copyright
0 likesJulia schlau du bist in Cody kenne ich hab doch okay
1 likeYeah this is a miracle yeah Gracie Carrabelle body we can get that if you want to I’m not bad but they can get that if they want to this is America
0 likesI hate goodman as much as Jeffy. Maybe because it is voiced by the same person
1 likeYyyyyyyyyyyeeeeeeeeeeyyyyyyyyyyyy
0 likesYa
0 likesCookie crisp
0 likesi like cookie crisp
0 likesFire
0 likesSit here laughing my ass off cuz this is funny as hell 🤣
2 likeshow are you gonna get fat from a few cookie crisps lol
0 likes👮🏽♂️🖕🏽😂
0 likesHi
0 likesHi
0 likes$10
0 likeswell now he has got diabetes in present day
0 likesI am a big fan
0 likesPark
0 likesWhat happened to the officer inside the house
0 likesHi
1 likeJoseph does not have power
0 likesNasty food for breakfast
0 likesI like it
1 likemy fav is lucky charms
0 likesCody is like the middle child
0 likesLast Video With Joseph & Cody As Plushies I’m Just A Fan Page
0 likesWho else is watching this while eating Cookie Crisp
0 likesDon’t curse don’t say Gods name in vain turn to Jesus he died for u so u could go to heaven and don’t lie
0 likesI remember watching SML when I was younger and thought that the funniest comment wins a video game thing is real
1 likedoes anyone realise that codys dad said cody liked bacon but they're jewish
0 likesI live in America 2
0 likes🥦🥦🥬🥦🥦🥒🥦🍆🥑🍠🥔🥜
0 likesAwrong
0 likesWho in the hell eats vegetables for breakfast
0 likesAnd dont hit people with a hammer
0 likeswww do
0 likeshi
0 likesCookie Crisp
1 likeCookie Crisp
Ba da ba ba bah, I’m Cookie Crisp
(Wait, that’s McDonald’s)
I’m cuckoo for Cookie Crisp (That’s Coco Puffs)
They’re magically delicious (That’s Lucky Charms)
They’re magically delicious (What?)
Silly Rabbit! Cookie Crisp is for breakfast!
(Okay, that was Trix)
The cereal that smiles back (Goldfish)
They’re dangerously cheesy (Cheetos)
You can taste the rainbow (Yeah, that’s Skittles)
I’m a Cookie Crisp now (What? Huggies?)
Like a good neighbor (Wha-? What?)
Cookie Crisp is there (State Farm?)
Cookie Crisp gives you wiings (Redbull?)
Gimme a break (What?)
Gimme a break of that Cookie Crisp (Kit Kat?)
Finger lickin’ good (KFC?)
They’re great! (Frosted Flakes?)
OH YEAH! (Kool-Aid?)
We have the meats! (Arby’s?)
Have it your way (Burger King)
Cookie Crisp, you’re in good hands (Allstate?)
Replies (1)
Yo thats alot to write
0 likesi like how joseph eats his cookie crisp like woodytw
3 likesbut veggs are good but chef pepe sohuldent do that
0 likesI wonder how many times Logan missed throwing that bowl of vegetables and hit lovell in the face
2 likesCe
0 likesgalaxies favorite cereal is cinaamon toast crunsh
0 likesGoodman suing his own employees? Brooklyn guy works everywhere.
3 likeshow would brooklyn guy know to go to codys house for the ps5?
0 likesReplies (1)
Idk
0 likesCody knows every slogant for every company ever
9 likesThe trio are such picky eaters!
0 likesU don’t want Diabetes I know cause I have it
0 likesI hate Cody🤬
1 like0:02 hi timed users
2 likesReplies (3)
sup
0 likes@roll the dice you canadians yo
0 likesSup dude
0 likesKarma hit
0 likesi thought cody was juwish he doesnt eat bacon!!!!
0 likesI have one cookie crisp cookie crisp are you can eat is cookie Chris
0 likesI laughed so hard when tyrone was about to answer the door and he opened it Brooklyn guy said hey there sir Tyrone freak out he said ahhhh it’s the cops😂🤣😆🤣😂😆
1 likeReplies (1)
👋
0 likesthe one lesson of this video is not to steal but you can copyright people and get sued
0 likesEw
0 likesngl cookie crisps are kinda trash
0 likesJr said if colors can get arong
0 likesT
0 likescookie
0 likes2:21 Bruh why is Joseph eating the cookie crisp like a bird? 🤣🤣🤣🤣
21 likesReplies (5)
sezure
0 likesHe wants a bird but he can't afford one because he's poor so he's treating himself like a bird and eat like a bird and chirps sometimes and other bird stuff
1 likemade me laght
0 likesBecause he can
0 likesbeacuse yes
0 likesPrank video 👎
0 likesMe eating cookie crust while watching: wow I know the furture
1 likeReplies (1)
Yea cookie crust is so good
0 likesAt the start of the vid. Jr: I can’t wait to eat cookie crisp and my friends for breakfast 🍳
12 likesReplies (5)
with my friends*
0 likes@Gavin Marlin but it sounds like what I said that’s the joke
0 likes@Char football that's the shittest joke I have ever heard
2 likesThat is the crappiest joke ever
1 likecookle :d
0 likesChef Pee Pee: My mom every school morning
5 likesJr: Me every morning.
Replies (1)
@Ì Àm Ķēvïn BB GO AWAY
0 likesthe funniest part is when Joseph said COOOOOKIE CRISP and ate it like a woodpecker
18 likesReplies (1)
Time stamp
0 likes“Ba ba ba ba ba im suing it”
4 likesI really want that backwards day video 😩
3 likesAnd second thing we learned today is don't hit people with a hammer
27 likesReplies (2)
@Poltergeist NOOOO
0 likes@flippaxd but yes
0 likesYou should make one named ms Goodman She should come and get Mario’s house payment in a suit like Goodman and Mario says who are you.
4 likesReplies (1)
subscribe to me right now why my video is going to premiere on power ranger dino fury The Official Premiere date reveal
0 likesWhen Junior is singing a song, Cody thinks that Junior mess up the song. It is because he stole ideas from other companies and that song is going to get sued. Cody knew that this song is sued because Goodman is the CEO of other companies and thinks that they stole other ideas.
9 likesReplies (2)
no shit sherlock that’s the whole plot of the episode
2 likesI know
0 likesI was about to ear Cookie crisp but theres no milk me time to water
2 likesCody:”we’re gonna get sued”
138 likesForeshadowinggggg
Replies (10)
ye lol
3 likesJunior: n o w e are not i said it 1st
1 likeCody were gonna get sued: jr:no where not. nintendo:YES YOU ARE if you keep using my pulshies
3 likes@wallewalle 777 really u had to say that
1 like@Princess Williams i just think its funny how logan can see the future so in a way yes I dont mean anything by it
0 likesI'm gonna die cuz Jr is like ba ba ba ba BÀAAAAAAAA
1 likeLol
0 likesJR WTH
0 likesLMAO-
0 likesDang Cody is a physic
0 likeswho the hell eats vegetables for breakfast
2 likes"Its too similar we're gonna get sued"
76 likesthat didn't age well
Replies (10)
Aged like milk
1 likeWut happened I haven’t been here for a long time
1 like@mineCrafter 2014 lol SML got sued by Nintendo so they had to switch from Mario plushies to bootleg puppets of themselves
0 likes@Dob oh wow
0 likes@mineCrafter 2014 he got sued for useing Nintendo plushies and characters
0 likesThen why didn't SML use BOOTLEG versions of the Nintendo characters? -_0
1 like@Victor E. Vector M. they didint have them at the time when they were making the videos they only had plushies the puppets were made recently
0 likesIt was inevitable
1 like@Dob I don't get how this works. You CAN make parody work and transformative work. It's part of the Copyright law. Nintendo is just a super hypocrite and likes to sue and shut down everybody. They sued a popular ROM site for NES games for millions of dollars. Then used those same ROMs to sell them on their stupid mini consoles.
0 likes@Bryce Carr pee
1 likeJunior: THIS IS USA 🇺🇸: me I thought u lived in Florida
3 likesI have a video idea that Jackie chu goes on holiday and goodman takes over the class . Then Jeffy is really bad for good man so goodman says to mario if jeffy can be good in class he will pay of his house and in the last minute of school jeffy does something bad
36 likesReplies (12)
OMG THAT IS A GOOD F***ING IDEA
4 likesOh wow I wish dis stuff was real 🙁
3 likeshttps://youtu.be/aNOI2v5izN8
0 likeshttps://youtu.be/aNOI2v5izN8
0 likesGood idea
1 likeGood idea I approve
1 likeIt is a good idea but why would Goodman want to teach the class.
1 likeGood one
0 likes@leballbuss
0 likesYehh
And jeffy needs to tell goodman he is f$&@king high
0 likesHehe
0 likesi like my idea aswell
0 likesMe: Rembering the Lamp video:
30 likesME: Here we go again
Replies (4)
Literally same
1 likeI even watch it in my downloads
1 like@Lanz9000 cool
0 likesSame
1 like"You can't out cookie the crisp "
9 likesWhy did Junior win a PS5 again? Didn’t he won one already in “The Candy Salesmen” or someone accidentally opened the door which let Jackie Chu inside the house to take away all for the rewards that Junior and his friends got including the PS5 because he must have continued knocking the door. However Cody is the one who gets to keep which is fair.
7 likesReplies (2)
I think it's the box for the PS5.
0 likes@Sean McAfee Yes! It is!
0 likesSome people say that infinity war is the largest crossover, little did they know there was 5:37
41 likesReplies (1)
@Red_Mask-Warrior that's called the nonexistent sml movie
0 likes"Talk back to me one more time and I'll turn on the disposal"
13 likesI never knew I would ever hear these words and be so intimidated.
Replies (6)
Hehe...
0 likesWhy does Cody dad look different
0 likesHello everyone! I'm sorry for Self Promoting but I'm fixing to have Surgery and it would be nice if you all helped me hit 10k 😊
0 likeshttps://www.youtube.com/watch?v=iWfOTbaufqQ.
0 likes@graham cracker idc
0 likesMaritime
0 likeswhen Brooklyn guy was on TV Codys song, "I'm an apple tree" theme was in the backround
1 like13:10 funny asl 😭😭💀 lettuce guacamole bacon tomatoes 😭😭😭😭😭
1 like5:37 Cookie Crisp song lyrics:
112 likesJR: “Hey, Cody.”
Cody: “Yeah?”
JR: “Let me tell you about the best mother frickin’ cereal you can buy.”
Cody: “What is it, JR?”
JR: “Well….it’s these cookies that you can eat for breakfast.”
Cody: “For breakfast?”
JR: “yeah! For breakfast.”
Cody: “what’s the cereal called, JR?”
JR: “it’s called…Cookie Crisp.
JR and Cody singing: “Cookie Crisp, Cookie Crisp!
Ba, ba, ba, ba, baaaaaa, I’m Cookie Crisp.”
Cody: “wait that McDonald’s”
JR: “I’m coo, coo, for Cookie Crisp.”
Cody: “that’s Cocoa Puffs.”
JR: “their magically delicious”
Cody: “Th-that’s lucky charms”
JR: “their magical delicious”
Cody: “What?”
JR: “silly rabbit, Cookie Crisp is for breakfast!”
Cody: “Ok! That was trixs”
JR: “the cereal that smiles back”
Cody: “Goldfish”
JR: “their dangerously cheesy”
Cody: “Cheetos”
JR: “you can taste the rainbooooow”
Cody: “yeah, that skittles”
JR: “I’m a Cookie Crisp now!”
Cody: “HUGGIES?!”
JR: “like a good neighbooor, Cookie Crisp is there.”
Cody: “state farm?”
JR: “Cookie Crisp gives you wiiings”
Cody: “Red Bull”
JR: “give me a break!”
Cody: “What?”
JR: “give me a break of that Cookie Crisp!”
Cody: “KitKat?!”
JR: “finger lookin’ good”
Cody: “kfc”
JR: “theeeir great!”
Cody: “frosted flakes”
JR: “ooooooh yeah!”
Cody: “koolaid”
JR: “we have the meats”
Cody: “Arby’s?!”
JR: “have it your way”
Cody: “Burger King?”
JR: “Cookie Crisp, your in good hands”
Cody: “Allstate!”
JR: “Cookie Crisp”
Cody: “no, no, guys, guys, shut up”
JR: “Cookie Crisp”
Cody: “n-no, guys, we can’t do this, this is stealing.”
JR: “Ba, ba, ba, ba, baaaa, I’m Cookie Crisp”
Cody: “you see? Th- this is clearly McDonald’s. This is stealing, is what I’m talking about”
Cody: “guys! We’re gonna get in trouble, we just can’t keep stealing other-“
JR: “im coo, coo, for Cookie Crisp”
Cody: “no, it’s Cocoa Puffs”
Cody: “guys, ok look, guys, I don’t want to have any part of this, im leaving.”
JR while Cody was talking: “their magically delicious, their magically delicious. Silly rabbit, Cookie Crisp is for breakfast.”
Replies (8)
Awesome comment lol
7 likesthanks for the lyrics, dude! i had no idea what they were saying.
2 likesthx lol
3 likesWow i can't believe that you memorise the cookie crisp's lyrics
2 likesUnderrated comment moment
4 likesAwesome dude
2 likes@BeastYT go think about your life then go swim with sharks
2 likesLmao
1 likeOHHHHHHHHH YAAAAAAAAAAAAAAAA
2 likesOkay sharing this: this was playing on my school laptop and I forgot to take the tab off and then I took the chrome book out of the case opened this and this played and I was so embarrassed 🙈
6 likesReplies (1)
Timestamp of when you opened it?
2 likes5:42 IM DEAD 🤣
3 likesI like when their singing
2 likesReplies (1)
Their singing... their singing what exactly? what do they own that is singing?
0 likesThe video I murdered my best friend !!! The end question what is your favorite thing to do not hate thp
0 likesI thought it would be “it’s to die for!” I was very wrong
13 likesReplies (2)
You mean that thing from jeffys Tacos
0 likesOkay I’m just going to go to bed early
0 likesthe song was actually good
3 likes15:40 no caption needed
0 likesThis was uploaded on my birthday
0 likesIs Cody's voice actor double masking? I usually dont notice it
0 likes7:00 oh yeah
0 likesSml Question what is your favourite cereal:
0 likesCookie Crisp gives you wings! ha that’s my fav lyric
0 likesBrooklyn T. Guy: steals PS5 from cody
0 likesBrooklyn T. Guy in the end of the video: don't steal
Me: like you stole that PS5 earlier :/
Wait I just noticed how would the cop know that the ps5 was at Cody’s house if he brought it to juniors it’s not like he saw the coin flip
0 likesThat song wa 🔥
0 likes2:21 LOL 😂
0 likesHa I called you Joseph Cody and I k!lied chef p p
1 likeI like the way Cody’s just talking and junior doesn’t give a shit
11 likesJust image how many dues there going to get
0 likesSml Idea: Goodman goes bankrupt
0 likesHow T guy know where to find the PS5 he go power’s
0 likesWe’re going to win a PlayStation five and we’re all going to have one anymore and I want
0 likesJeffy in the back round ohh at the end
0 likeswait didn’t the Brooklyn guy give the PS5 to Junior so how does he know it’s with Cody???
0 likesOMG....lol AT THE END OF THE DAY KIDS LOVE COOKIES SO OBLISLY KIDS SHOULD LIKE COOKIE KRISPS LOL THESES STUFF CRACK ME UP KEEP UP THE GREAT WORK LUV YA... HASTAG... PINK HEARTSSSSSS......
0 likesCoooookie crisis there magically deliciooooouuuusss
0 likes0:02 ßæęøōąăçãđqəřəþīįîì
0 likesWhat cookies😂
0 likesCody makes the song good and I'm eating cookie crisp
0 likesMe the Cookie crisp song was original Mr Goodman bah bah bah bah lm suing you
0 likesI’m coo coo for cookie crisp
0 likes5:38
1 likeBruh look at the sdued
0 likesHow to get sued/copyrighted: 5:37
0 likes2:21 💀💀
0 likesI’m littery eating a bowl of Cookie Crisp right now…..
0 likesI don't understand why Joseph was singing when wasn't there lol
0 likesHe could've said Yare Yare daze cause it means good grief
0 likesThe song was fire
1 likeImagine this video has deleted scenes when Bowser Junior wakes up and in the PlayStation 5 is gone and you're telling Joseph and Cody the PlayStation 5 and Cody was right they cover the slogans
0 likesWait Joseph can’t play it because he don’t have power
0 likesMy favorite sereal has to be trix
0 likes5:22
0 likesWhat is Joseph going to play it on he’s poor
0 likesYou should remake ths
0 likesOne of the best sml videos
0 likesFroot loops
0 likesCookie Krispy I’m eating it rn
0 likesTo be honest I sang with junior lol
0 likesThe Dark jai cereal
0 likesHow did guy know the ps5 was at Cody house
0 likesI made my own Jeffy puppet
0 likesstate farm💀💀
0 likesCookie 🍪 crisp I'm love 💘it
0 likesi'm cookie crisp
0 likes6 months is January February March april may June
0 likesI love it
0 likesNew vid idea jeffy's little brother
0 likesWait these the original puppet what
0 likesI like when jr said uuuuuuuuuuh
0 likes16:38 only ogs know what their mocking
10 likesReplies (2)
Lol
1 likeIk what u mean
1 likeCoooooookie crisp!
0 likesThe song should win a grammy
0 likesHaahahhahahahahahahaah
0 likesActully junior you did 1% of effort and Cody did 90% effort
0 likessml 2020
0 likesKnow Wonder they got age restricted they copyrighted allot and allot of companies so ye 😂😂😂
0 likesLike a good neighbour State Farm is there
0 likesHMM
0 likes6.57
0 likesOh good job cody you ruined the song😤
1 likeI have a feeling because the song you got torn in half by YouTube
0 likesI have cookie crisp top of The fridge
0 likesCookie crisps
1 like🥶🥵
0 likesJunior Cody and Joseph mentioned chip the wolf
0 likes하지만 이런 상황에서 복귀 절차를 사실 이라며
1 likeAwe it's been years since I've watched this
6 likesReplies (1)
YEARS? It’s only been like 8 months or 1 year. Fake fan…
0 likesCokie crisp
1 likeJeffyPRO
0 likesYou stole know him
0 likesNo cap those vegetables that Chef pp made they look good
0 likesThe more you fail the more good luck you get
0 likesLol😋
1 likeMichael Jackson
0 likesفغل ن بحب بع
0 likesI love you videos
0 likesbooooooooooooo
0 likesMe pp
0 likescook it crisp. Cookie Crisp
0 likesAnybody watching this while eating cookie crisp?
0 likesCookie crisps got to eat them all
0 likesMy favorite cereal is Lucky charms
0 likesYOU SPOILED IT FOR ME
0 likesCocoa pebbles
0 likesSong is good and how the heck johspeh get a spoon?
0 likesI’m a cookie crisp now like a good
0 likesbaba bop bop ba I'm suin it
0 likesEėe
0 likesCoOkIE CrISp
0 likesHi mate didnt get a photo
0 likesWhat is this cookie kit to cut
0 likesMy fav cereal is L-L-L-L LUCKY CHARMS
0 likesCookies crispy
0 likesThere is also a rabbit that is on chocolate cereal
0 likesLol
1 likeI like coco puffs
0 likesCookie crisps cookie crisps PA PA cookie crisps
0 likesHi
0 likesHi
0 likesCookie crisp
0 likesUmmm there is a mistake cody sang too and junior and joseph are saying he only hold the camera
0 likesBesides Frosted Flakes, the rest of the cereal slogans are owned by the same company as Cookie Crisp.
1 likejeffy
0 likesI’m not joking it’s fire
0 likesDogs a long time ago dogs we’re wolfs that’s why he will die
0 likesJeffy
0 likesJeffy
0 likesMy fav ceareal is obviously fruitloops
0 likesIonioono
0 likes"it's pumpkin time" -junior
2 likesCookie crisp banana on cookie crisp
0 likesWho am I Spider-Man - Brooklyn T guy 2021-2025
0 likesCinnamon toast crunch
0 likesPolice T guy should be arrested for hitting Junior
1 likeAm
0 likesLol the song funny Cody names everything
0 likesSuper Mario Logan:
0 likesMr. potato head
Date of birth: Jan 23 2005
Gender: male
Cast: Lance thirtyacre (formerly)
Lovell Stanton (in jeffy's magical pencil)
Episode: food scam
Replies (1)
Super Mario Logan:
0 likesLuigi
Date of birth: November 26 2010
Gender: male
Cast: Logan Thirtyacre (formerly)
Chris Netherton (in sml movie: ghost)
I thought Jewish can’t eat bacon and
1 likeDoesnt Goodman have like a couple billion PlayStation five in his house
😇😈
0 likesSa
0 likesNext 6 months July August September October November dec
0 likesفنيهفسف
0 likes𝗧𝗵𝗶𝘀 𝗶𝘀 𝘀𝗼 𝗳𝘂𝗻𝗻𝘆𝘆
0 likesmake a video where junior gets diabetes
0 likesIt would have been better if it went like this
0 likesJunior “ if it lands heads I get to keeps it”
Junior “if it lands tails Joseph keeps it”
Cody “what about me”
Junior “what about you”
Cody “How do I get the ps5”
Junior “You don’t”
Cody “ why I held the camera”
Junior “because you did basically nothing
Mine is trix
0 likesTho
0 likesفاابهغفف
0 likesPog
1 likeFNF
0 likesPolice puppet could have said that the boogeyman hides in the ps5 so kids can take it
0 likesJunior the both get arong
0 likesi hade vegetable but i like fruite
0 likesCody did nothing because he said i had the camera 📷 no he didn't he was in the video
0 likes😎🤢🐝
0 likes❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤
0 likesSo th boogeyman can steel the kids
0 likesIs the song
0 likesY
0 likeschef pee pee is such a DICK.
0 likesI’m taking a shit while writing this in my ass hurts a lot but this is like the funniest video I’ve ever seen
0 likesHi
1 likeReplies (1)
What
1 like😍😍😊😚☺😻❤👍
1 likeMichelle Michelle. Michelle. Michelle. Michelle. Michelle Michelle. On my way! On my way! Wow
0 likesA
0 likesWhy does the cop play spider man if police don’t like Spider-Man🤔
1 likeIt’s funny how they say cookie Chris instead of Cookie Crisp
0 likesReplies (1)
Maybe copyright
0 likesSay hamburbur! If u want McDonald burbur
0 likesI have one question why is Junior f**** stupid
0 likeshi
0 likeshi
hi
hi
I got diabetes from not eating cookie crisp .-.
0 likesCody. No we only get one PlayStation .Junior. no we haven't won it yet . Like are they dumb 😲🤯
0 likesCody: Pizza hut Arbys Jr: ignoring Cody
0 likes😹😹😹😹😹😹😹😂😂😂😂😂😂🤣🤣🤣🤣🤣😅😅
0 likesÃ
0 likesSML SMLLLL bababba im SML im SM for SML the best shop awer the best shop awer silly rappet SML the best store gimme a break gimme a break with this SML SML SMLLLLLLL bababababa im SMl i love your vids :)
0 likesLucky Charms
0 likesReplies (1)
No
0 likesGOD BLESS WHOEVER'S READING THIS JUST KNOW THAT GOD LOVES YOU AND HE IS WITH YOU AND HE DOES ANSWER YOUR PRAYERS ❤😇
1655 likesReplies (426)
God bless you too
65 likesNo
75 likesGod bless you three
41 likesThanks
35 likesMildSprite why you say no
20 likesBecause he is dum
17 likesWhat if I don't believe in god
35 likesDude why do you make comments if you don’t mean them you just want likes
27 likes@Bio Lab why you asking
10 likes@Roy the viewermost likely to show his friends how many likes he got
13 likes@DatFurry Boi that's what I'm saying bro some people here don't believe in god
20 likesNice
11 likes@Issak Robin Then how is the earth created?!
13 likes@Itz_Hanna Chan you tell me Mr I have to ask other people what answers to questions are cause I'm a dumb ass
9 likesGod bless you too
10 likesGod blessed you all redy
9 likesI dont believe in God
12 likesTy soo much god bless u to
8 likesGod bless you four
7 likesDon’t believe in god but Hope you have good day to
10 likes@Chef Pee Pee My parents did, and there was no need to call me a dumbass
4 likesWhat if I’m jewish...
9 likesGod bless you man
9 likesY’all fr could’ve ignored this but all of you went out of your way to spread hate on this kind person spreading what they believe in also @Issak, if literally nobody cares, what was the point of replying to their comment?
9 likesHe's just being nice
4 likes@Issak Robin Yo, stop being rude, ur just trying to be rude to this guy. Ur probably a jerk irl. He's just trying to be nice to y'all, but y'all are mad rude. Just learn how to be nice not a rude jerk.
4 likesGod isn’t real
7 likes@Mars Alien Actually he is.
7 likesSame to you
5 likesGod bless you for loving God
7 likesEven if you don’t believe in god still just be nice I mean like come on guys.
7 likesAMEN. ✝️🙏🏽❤️💯👍🏽
6 likesamen
4 likesYou too
4 likesI don’t believe in god
5 likesThanks man
6 likesGOD IS SO GREAT AND WISE AND SMART AND INTELLIGENT WE ALL SHOULD PRAY TO HIM
10 likesThe same to do 😊
7 likes@Random name what’s wrong wit u??
6 likesGod bless u too.
7 likesWho the fuck cares
5 likes@LuvxRage nothing why
1 like@Nigel Hards same
4 likes@Random name u is being real negative bro
4 likesLol saying that for comments and likes lol
6 likesShut up
4 likesGod bless you to😙🙏
5 likesI swear this guy is a bot
2 likes@LuvxRage how so
2 likesWhy are there so many god or jesus comments now
4 likes@Maaz Farhan the epic gamer hell no
3 likesShut up Christian
5 likes@Chef Pee Pee Proof?
3 likesGod loves you too!
3 likesThx
2 likesBullshit cuz in November my uncel died and we prayed but did he life? No he passed away
3 likesMay Allah bless you too brother
2 likes@Boyk my dad got alzheimer's and passed away in October and have I lost my faith? No cause I know he's in a better place then this world
3 likesGod bless you
3 likes@Zack'sCollectibles Evry body has diffrent reactions to lossing people btw I'm sorry U lost him
3 likes@Francheska Colon Oquendo shut the fuck up
3 likesStfu
2 likesUhhm
3 likesGOD BLESS YOU ALL
5 likesAlso why did god move my crush to the other side of the god dam country (Australia)
3 likesGod bless your life your mom,s life and your dad, life.bro
3 likesGod bless you. And remember God made you special and He loves you very much
3 likesThis is a wierd comment for a youtube vid
5 likes@Jordan Robinson he hates me
3 likes@Random name bye.
2 likes@LuckyMarioBros you can go that's fine
3 likesArtheism pog
2 likes@Federal Bureau of Investigation bitch
3 likes@72_Sackzzz Nigga go read bible
3 likes@Mars Alien SHUT UP BITCH HE IS
3 likes@Cameron May fuck you too
3 likes@Chase Czarnecki than get out
3 likesTysm ❤
3 likesLet's see how much subs I can get from this comment
2 likesAim 100
Current 5
Let's see how much subs I can get from this comment
2 likesAim 100
Current 5
God bless you
2 likes@Bio Lab he said no because of how rude he is
1 likei’m an atheist
3 likesCookies 🍪
4 likesno
3 likesCap
3 likesGod bless you tube
2 likes@Chef Pee Pee 😂😂😂😂😂😂
2 likes@Kaiplays yes dumb ass
3 likes@Cameron May you too
2 likesYOU DISGUST ME HAIL SATAN
3 likes@Nini Trochez I think you should go to school and fix that grammar “nigga”.
2 likes@iambigscare Let's see how much subs I can get from this comment
2 likesAim 100
Current 5
God bless you too
2 likes@Random name ha
2 likesAm geting blessed bc my birthday is in 6 days
2 likesThis came out of nowhere but thank youbless you too
3 likes@Cameron May YEAH YOU TO
2 likesLike begger
2 likesGod bless man
2 likes🛑bot alert🛑
2 likesOh yes
2 likesGod bless yoh
2 likesI wonder why you put this on a channel that used to swear
2 likesGod bless you 🙏
3 likesThe wolf is going to die dude f**** wolf
2 likesI don’t believe in tod
2 likesWell thanks
2 likes@Agent Coconut VR YOU DISGUST ME HAIL SATAN
1 like@Chef Pee Pee gods not real B)
1 likeThank you I hope you do to
3 likesNo you
1 like@Venus HAIL SATAN
1 like@Zombie Man cuz I wanna
1 likeThank you
4 likesThanks Amen
4 likesGod bless everyone
3 likes@Maaz Farhan the epic gamer yes
1 likeK
0 likesGod bless you to
4 likes@Issak Robin shut the fuck up asshole
1 like@DatFurry Boi good point brah
1 likeAmen thanks
4 likesGod bless you all
2 likesGod don't exist
0 likesGod bless you
1 likeI'm don't believe in God and no ,-,
0 likesWe love u brotha
1 like@Itz_Hanna Chan probably just naturally created just like every other non man made things
0 likes@Aldsworth 1 cap
0 likes@Chef Pee Pee i with u god is real he made us and i watch super bowser logan
0 likes@HackerMarioBros yes he does u need jesus
0 likes@HackerMarioBrosbro relax ur entitled to ur opinion
0 likes@Cobrakai390 rude, much
0 likesYeah I know those stuff I go to church every Sunday God bless everyone and I pray before I go to bed
0 likes@Francheska Colon Oquendo nah bitch he ain’t real you have been lied to
0 likes@Maaz Farhan the epic gamer nah he isn’t real you moron
0 likes@Chase Czarnecki finally someone who’s not stupid
0 likes@HackerMarioBros agreed
0 likes@Redtrainer46 good
0 likes@Nini Trochez you are stupid god isn’t real you have been lied to child
0 likes@Chef Pee Pee “finally someone that believes in an stupid lie”
0 likes@Zombie Man there’s no hell idiot
0 likes@Christmas Granny🎄 satan ain’t real moron
0 likes@Chef Pee Pee we evolved from apes nitwit
0 likes@Gus stupid god isn’t real and we are wasting time believing he is
0 likes@MR stfu
0 likes@Clementina Méndez shut up
0 likes@ØP ØPS no such thing as blessed
1 like@Sonicwatchingvideos blessings aren’t real moron
0 likes@Aldsworth 1 agreed
0 likes@iambigscare good
0 likes@Mars Alien what
0 likes@Bio Lab because they can.
0 likes@Issak Robin okay? there’s nothing wrong with that. lmao let people have their own beliefs
0 likes@PachyLordTaco 21 then own it, believe what you want to
0 likes@Kaiplays as you should
0 likes@Mars Alien thank you
0 likes@Mars Alien wait what you said thank god then edited to this
0 likes@nina if we believe in the obvious false then we waste time
0 likes@Mars Alien what do you mean by good?
0 likes@Yoshua Azany I know but I really don't even believe in god or jesus
0 likes@Random name go to hell then
0 likes@Random name be with devil tell me what it. like
0 likes@Chef Pee Pee mhmm bless
0 likes@Mars Alien HE IS REAL IDIOT
0 likeswell im done talking for today GODBLESS YALL AND I HOPE U GO TO HEAVEN ,EXCEPT FOR people WHO TALKING CRAP ABOUT GOD
2 likes@Nini Trochez I dont believe in the devil either so
1 like@Christmas Granny🎄 You disgust me more hail god
1 like@MonkeyD Gaming HAIL SATAN BITCH
0 likesYou're my hero my dog died a few days ago and you maid me believe that God saw my prayers I love you you have maid my day
1 like@Kelli Costello EWWW RELIGION
0 likesJust because I’m white doesn’t mean I’m not a Buddist
0 likes@SlapZero I never said you were dumbass
0 likesThanks God Bless You
1 likeWhat does this have to do with the video
0 likes@Kaiplays HAIL SATAN
0 likes@Francheska Colon Oquendo Actually he isn't there is no scientific proof
0 likes@Maaz Farhan the epic gamer no bitch
0 likes@Nini Trochez No he doesn't
0 likes@Nini Trochez ALSO IF YOU ACTUALLY WERE A CHRISTIAN YOU WOULDN'T HAVE SWORN
0 likes@Itz_Hanna Chan How about the formation of our universe
0 likes@Arlos There is no scientific evidence of "hell god Jesus " Exisisting stupid
0 likes@Cobrakai390 Same to you
0 likes@Nini Trochez no he didn't our parents did
0 likes@Nini Trochez no I don't
0 likes@Mars Alien Rude much
0 likes@Cobrakai390 YOU ARE A DISGRACE TO HUMANITY
0 likesGod bless💙
0 likesGod bless you too
0 likesSir please this isn't the right video
0 likesGod bless you too
1 likeAstakfirallah-hul-azeem
1 likehe dont
0 likesGod bless everyone :)
0 likes@Chico they can't accept the truth u can't say u don't believe in something if it's not real . 😁
0 likesGod bless h
0 likesI appreciate it but I'm more of the scientific type I don't believe In god
0 likes@Chico don’t really care
0 likes@Francheska Colon Oquendo don’t really care
0 likesI'm sorry I don't belive in God but thank you for making people day better
0 likesThx you blessings to
0 likesGo bless u too and thank u
0 likesGod Bless you too you have a very loving heart I appreciate you ❤️😇
0 likesWhich God???
0 likesThank you but I don’t believe in god but thank you 😊
0 likes@E- GIRL OwO g
0 likes0
0 likes@Bio Lab cause he can
0 likesGod bless you to 😇
0 likesIght did he answer my prayer to get friends I'll give you a hint NO!!!!
0 likesPlz not youtube
0 likesThank you for making feel better. good to know there's good people still
0 likesNo he doesn't answer my prayers
0 likes@abhishek niraj he will soon
0 likesI sadly do not believe in god. I have nothing against people who do believe in him but the people who do. I think it’s a total lie that he exists.
0 likesOk back to you
0 likesHell nah 🧢
0 likesthanks!
0 likesI'm agnostic
1 likeIt was here obviously way before lol
0 likes@Itz_Hanna Chan The big bang.
0 likesbro this is sml…
0 likes@Itz_Hanna Chan big bang
1 likeUh I’m here 10 months later and uh this comment it bullshit
0 likes@Zahmora Johnson ikr
0 likesGod bless you too❤😇
0 likesI dont believe in god
0 likesThanks for the kind message
0 likes@Random name but why
0 likes@Sussy among us I was going thru stuff 9 months ago and I was just angry
0 likesAmén but your just happy SML made a video
0 likeswtf
0 likes@Mars Alien CAAAAAAAAP
1 like@Mars Alien CAAAAAAP
0 likes@Mars Alien STOP
0 likes@Mars Alien STOOP
0 likesGod bless you to tysm!!!
0 likesI have Alzheimer's and you need to get the video of the video of the video of the video of the video of the video of the video of the video of the video of the video
0 likesgod bless you
0 likesGod bless all of you guys
0 likesGod bless to you and all
0 likesGod bless you too 😊
0 likesWho ever says no is trash at everything
1 likeYou too 😀
1 likeITS A CHRISTIAN BOT
0 likesty sir and god bless you too
0 likesThank you God bless you
0 likesamen✝️
0 likes@Bio Lab because he is probably an aetheist or hindu, respect his opinion
0 likes@DatFurry Boi that completely fine
0 likesSame to you ✌️
1 likeGog died!!!!😪😵
0 likesTy
0 likesGod bless you to
0 likesGod bless
0 likesNobody asked for you to say that
0 likesGod bless ya
0 likesGod bless you too 269
0 likes@Random name if you going to disrespect God DO IT FRICKIN SOMEWHERE ELSE. Please😇
0 likesThank you<3
0 likes@acivy 😁
0 likesThank you so much
0 likesGod bless you and happy new year
0 likes@Bryan Nguyen God bless you too sir/ma'am
0 likesGod wants me to die
0 likes@J.F.A Jonsson Freiholtz Adolfsson DON'T YOU EVER SAY THAT IF ANYTHING HE WOULDN'T HAVE SENT HIS SON FOR YOU TO DIE FOR YOU. If you need a hug just say that ❤️💕❤️
0 likesGod bless you
0 likes@Itz_Hanna Chan by 1 destroyed planet or planets coming together and soon combining and done
0 likes@Francheska Colon Oquendo cap
0 likesMan all these people are ignorant i believe in god. I get it your doing good but why in this environment of youtube. And for the people who dont care KEEP IT TO YOURSELF we dont need to here anybodys thoughts i am not bias beacuse your just causing more conflict. Just shut up we came here to watch Sml not just try to end up in drama alert.
0 likesAmen 🙏
0 likesOk
0 likesEven though I don’t believe in god
E
0 likesRight back at ya
0 likesAmen 🙏
0 likesWhat- I done believe in god
0 likesI am lonely and depressed and no one will ever love me so no
0 likeskids fighting in a comment section, L🤡
0 likesyes
0 likes@Mars Alien How do you know
0 likesAmen
0 likesGod bless u to
0 likesGod bless u tooo
0 likesGod bless you
0 likesGod bless you
0 likesGod bless you
0 likesGod bless everyone
0 likes@★⃝꧁ Super 𓅓 Chasey ꧂ ★⃝ I know I'm already going I have things on my phone you don't want to see
0 likesBeans
0 likesThanks 🙏
0 likesThanks 🤲🤲
0 likes@72_Sackzzz no you
0 likes@Christmas Granny🎄bro you celebrate Christmas and Christmas is for baby Jesus 😇
0 likes@HackerMarioBros bro what 😮
0 likes@Christmas Granny🎄 no you are your going to hell Jesus died for our sins how could you
0 likes@THE FORBIDDEN ONE nerd 🤓
0 likes@Leslie Hernandez what
0 likes@Hank Hill god our only lord and savior
0 likes@WinterDxmon bro wtf
0 likes@Progamerpeas god bless
0 likes@Rust Bucket losef
0 likes@Aurya Wilborn 😇🙏🙏😇
0 likes@zack zachary yeah 😇🙏⛪️🛐
0 likes@SUPER MARIO PLUSH CHANNEL! wouldn't that also make you a nerd for knowing and remembering?🤔 How old is that show now? And you still remember that episode
0 likes@SUPER MARIO PLUSH CHANNEL! I'm sorry for what I'm about to say
1 likeNow stop reply b
1 like@THE FORBIDDEN ONE and you said to respect others but you can’t even respect god in Jesus name
1 like@THE FORBIDDEN ONE whatever’
1 like@SUPER MARIO PLUSH CHANNEL!bro you started it
0 likes@SUPER MARIO PLUSH CHANNEL! I bet you pray for a bagel every night
0 likes@SUPER MARIO PLUSH CHANNEL!to think a 10 year old could trigger me this much and I'm TRYING so hard to hold back
0 likes@SUPER MARIO PLUSH CHANNEL! and if you "respect god" them why don't you follow the bible?
1 like@SUPER MARIO PLUSH CHANNEL! ps you can't report bc you started it and it would just back fire onto you
1 likeAlso there might be ya know "dangerous people" here and ya might get "napped" if you're not careful so be safe kid I hope you don't learn the hard way 😅😅😅😉
0 likes@SUPER MARIO PLUSH CHANNEL! I'm sorry. I only know the word L-O-S-E-R not losef learn to type
1 like@Ma Cox small bot
0 likesLOL
0 likes@Christmas Granny🎄 your mom does
1 like@THE FORBIDDEN ONEchoad nugget
0 likes@THE FORBIDDEN ONE i do
0 likes@THE FORBIDDEN ONE no your not bro trying not to look bad in public haha sad
0 likes@THE FORBIDDEN ONE no wonder your “FORBIDDEN”
0 likes@UCfnxDGdHvvcsFicizSVHTTw rust bucket 🪣 hey I mean it fit your self
1 like@SUPER MARIO PLUSH CHANNEL! "OHHH DUUUUURRR OOOOHHHH MEE GONNNNAAAA COPPY THIIIIIIISSSS SMLLLLLL DUDDEE DURRR HURRRRR HURRRRR AND MMMMAKE MYYYY OWN CHANNNEL DUUUUUR IMMMM GONNNA CALLLLL ITTTT SMPC SOUUUNNNDS LIKKKE IMMM NOOOOTT COOPPPYINGGG AT ALLLLL DURRRR
0 likes@SUPER MARIO PLUSH CHANNEL! oh nice insult what are you in first GRADE!?
0 likes@Rust Bucket ok bro it’s over why are you so triggered
1 like@SUPER MARIO PLUSH CHANNEL! why wouldn't I dude called me a loser and called me trash
1 like@SUPER MARIO PLUSH CHANNEL! Bro are you trying to start a fight again 😑
1 like@THE FORBIDDEN ONE look no bro but look let’s just say sorry already this internet fight is f in over
1 like@THE FORBIDDEN ONE damn bro no let both say sorry you act like you didn’t do anything
0 likes@THE FORBIDDEN ONE look here something from the Bible If we confess our sins, he is faithful and just to forgive us our sins and to cleanse us from all unrighteousness.
1 like@SUPER MARIO PLUSH CHANNEL! what the fuck I do🤔🤔🧐
1 like@SUPER MARIO PLUSH CHANNEL! Tell me what the fuck I did to get called name's
1 like@THE FORBIDDEN ONE it’s the end of you want to stay here and not say sorry cool bro sorry for bothering you but you also say sorry bro this is a internet fight we can’t end it SO LET’s JUST END IT
0 likes@SUPER MARIO PLUSH CHANNEL! Just because it's to hard
1 likePraying for forgiveness does NOTHING
1 like@THE FORBIDDEN ONE why dude do you want to go to hell or something why don’t you believe in god WHY
1 likefor example if a guy shoots a kid because he was mad then he prayed for forgiveness and got forgiven does that mean he don't have to go jail now because "god" forgave him
1 likeNO
1 likename a time someone got forgiven by God in this era who didn't go to jail.
1 likeFor committing a crime
1 like@THE FORBIDDEN ONE DUDE HE GOS TO JAIL BUT GOD FORGIVES HIM FOR HIS SIN
1 likeDO NOT TEST ME
1 like@SUPER MARIO PLUSH CHANNEL! bro and I'm also not adopted unlike u
0 likes@THE FORBIDDEN ONE god is real god is real god is great god is good
1 like@Christmas Granny🎄 what bro F off get out
1 like@SUPER MARIO PLUSH CHANNEL! Well according to you I'm going to hell so what your saying is you'll be there too? Oookkkk🤪🤪
0 likes@THE FORBIDDEN ONE well idk maybe you will go to heaven if you believe in god I pray everyday so show some respect to god in Jesus Christ name
1 like@SUPER MARIO PLUSH CHANNEL! alright kid I'm over you I'm just trying to have a nice day man why the hell you gotta be toxic I'm eating my favorite food and watching TV why do you gotta mess it up again now I don't even feel like eating
0 likes@THE FORBIDDEN ONE well I said sorry already why can’t you
1 like@SUPER MARIO PLUSH CHANNEL! because I'm not in the wrong here. you are
0 likes@THE FORBIDDEN ONE what are you talking about anyways bye forever ♾ ✌️
1 likeThank you, but I’m a atheist
0 likes@Random name why you say no
0 likesI dont believe in god but I appreciate the message
0 likesI'm atheist but u to 😃
2 likes@cholo V1nce this made me giggle
1 like@Mars Alien fu and quit trying to tell me a lie I believe in god
0 likes@Big baseballs⚾️ bro I swear people are so weird I also believe in god
1 like@SUPER MARIO PLUSH CHANNEL! ya
1 like@Christmas Granny🎄 your so funny
0 likesThx
0 likesHoyyyyyaaaa
0 likes@HackerMarioBros bro God forgive you know not like you would know
0 likes@Evan Janssen yeah this comment is so true people need to start believing
1 likeThx
0 likesAmen
1 likeim athiest
0 likesgod dont love me
0 likes@CarlOnDuty: Black Cops yeah he does just remember that 😀
1 likeAmen
0 likes@SUPER MARIO PLUSH CHANNEL! Your mad because I'm speaking facts? Lol.
1 likeAmen god bless you too
0 likesGod bless you too
0 likes@Kraken_STW 667 likes now
0 likesGod bless you
0 likesAnd bless your soul
1 likeThx God bless you too
1 like@Random name bruv
0 likesIm an atheist ⚛
0 likesThere is no god
0 likesAMAR12345678
0 likes@DatFurry Boi then don’t reply lmao
0 likes@Earth II there is a god
0 likes@Issak Robin its healthy ok?
0 likes@SUPER MARIO PLUSH CHANNEL! how the hell do you even know god is real
0 likes:)
0 likes@HackerMarioBros sure nigga bye ✌️
1 like@SUPER MARIO PLUSH CHANNEL! then if there is a god, then explain how he is real
0 likes@SUPER MARIO PLUSH CHANNEL! WHO HURT YOU 😭
1 likeBro I can’t believe the person that made this comment did it for clout
0 likes@SUPER MARIO PLUSH CHANNEL! do you want a hug my nigga
1 like@Ma Cox small p poo
0 likesGod bless you too
0 likesGod bless u all 😊
0 likesYou to
0 likes@SUPER MARIO PLUSH CHANNEL! Grammarly can help with your issues
0 likes@SUPER MARIO PLUSH CHANNEL! Lol you copy my quotes thats how bad your are at roasting people 🤣
0 likesGod bless u too 😇
1 like@Not15ktonEliab unknown god god bless all
1 likeU to god bless u
0 likesNo.
0 likes@Random name ok? So?
0 likes@SUPER MARIO PLUSH CHANNEL! Get ready to get expose because this whole dumb conversation leads to a ban for being racist to a black person.
0 likesI'll see you in my nexts video!!! 😘😘 Hopefully you can delete the comments while you can.
@Random name I
0 likesPrayers have been answered
0 likesRith
0 likesGay
0 likesThanks and amen ❤️🙏
0 likes@Ryan McGowan it's a kind of heart
0 likes@HackerMarioBros I’ll try you
0 likesNo
0 likesThanks god bless you to💜
0 likesLat
0 likesLast comment lol
0 likesThanks, amen.
0 likesThat is good
0 likesThank you
0 likesLast one god bless you and your family hope you have a good life and be careful
0 likesAtheism go brrrrrrr
0 likesgood bless you to
0 likesGod is good, god is great, god is goOOOOOO
0 likesI know
0 likesGod bless you 🙏 ❤️
0 likesGod bless you
0 likes"Ewwwww" 😂
7 likesSml idea :jailbreak bowser and mario dont have money to pay the house payment they rob a gas station and the cops get them they go to prison and the kids junior joseph jeffy cody make a plan to break them out sorry if its bad
4 likesNext day: Sponsored by all cereal companies.
23 likesReplies (8)
subscribe to me right now why my video is going to premiere on power ranger dino fury The Official Premiere date reveal
0 likesHow about she eats junior and joseph
0 likesyour profile picture is my Instagram picture
0 likesAhh yes
0 likes@GamersForceRevice785 fuck no, no wait delete your comment you low life human
0 likesSponsored by every single company
0 likes@The Instant Noodles don’t have to be so harsh on the kid like damn
0 likes@Raven Of TTG yeah you right, i gotta stop or he gonna start crying, thanks for the advice
2 likeswhat the hell happened to Tyrone, he looks different
19 likesReplies (5)
Ikr lmao
1 like@Caleb The Gamer 2011 yes sirrrrrr I’m verified be sure to subscribe for more
1 like@Carter your not verifed your just using a emoji
1 like@Carter welp your bad at being sarcastic
0 likes@GHOST HENCHMAN PRODUCTIONS Oh that’s because on the character selection screen I choose sarcastic asshole
0 likes1:43 cringe for vegetarians
4 likes"Junior, do you want diabetes" junior: Yes
77 likesReplies (14)
Hehe
0 likesHello everyone! I'm sorry for Self Promoting but I'm fixing to have Surgery and it would be nice if you all helped me hit 10k 😊
1 likeLol
0 likesWhy you want diabetes two?
1 likeExactly what happebed
0 likeshttps://youtu.be/VVSxuJRu-Q0
0 likesCatlogan animations productions I think they want diabetes three
0 likes@IanKava stfu getting 10k won’t help
1 likeUr comment got stolen by a dumb bot
1 like@IanKava ur not getting surgery plus subs won’t do anything for you “surgery”
1 likeWhat is better diabetes or PS5
0 likes@I Am KevinBB ok
0 likeshttps://youtu.be/VVSxuJRu-Q0
0 likesLOl
0 likesBroccolis are good tho if they’re good correctly
0 likesReplies (3)
🤢🤮
0 likes😋
0 likes@RyaNN😊
0 likesHow about you have Jerry’s ceral where mario signs him up for a constraint and Jeff wins by making a cereal with a ton a sweets then it out sells Brooklyn t guys cereal and idk hopes it’s good light went I do it on a month or something cus u just did a cereal or this I this Is trash
13 likesReplies (3)
I'm sorry? did you just call an SML movie trash?
1 likesurely I am seeing things
0 likesohhhh lmao or have one episode where JEFFY turns into a JERRY one day either he decides that to be his name or he forgets his name and thinks its Jerry or spelled that way or alternate personality or... alternate universe... ;) I know the SML crew likes that
0 likesHow did Brooklyn know where to go if he went to another house to give the PS5
15 likesReplies (1)
That’s what I thought
0 likesChef Peepee finally made somethin' good, and Junior didn't appreciate it. The ignorance...
6 likesReplies (1)
Hehe...
0 likesI like how Joseph was having a mental breakdown also my favorite cereal is frootloops.
5 likesThey forgot to say the second lesson don’t hit kids over the head with hammers!
9 likesReplies (2)
https://www.youtube.com/channel/UCCWXO9zJSjhJvUzCwAeeSlg/featured
0 likes@ClassicFilmCartoonfan007 Penny no
1 likeChef pee pee should of said “if you don’t eat your vegetables you’ll turn into Cody’s mom”
3 likesIdea: mr Goodman’s house payment
7 likesPlot: Goodman gets ready in his elephant a$$hole suit and his doorbell rings and it’s Elon musk or some other billionaire and ask for Goodman’s house payment and he can’t pay it and if he works for Mario and has to babysit jeffy and cook
Replies (1)
Hello everyone! I'm sorry for Self Promoting but I'm fixing to have Surgery and it would be nice if you all helped me hit 10k 😊
0 likesShef peepee:Junior do you want diabetes?
9 likesJunior:Yes.
Replies (1)
You mean CHEF peepee?
0 likes4:54 junior ends racism
3 likesWhen I saw the book in the beginning I was like aww there's that book
4 likesReplies (2)
https://www.youtube.com/channel/UCCWXO9zJSjhJvUzCwAeeSlg/featured
0 likesOk?
0 likes5:24 love how logan left the mistake in there of junior calling cody joseph lol
8 likesReplies (1)
Hi
1 likeBowser Junior's All Nighter: "What about a three-sided coin?"
3 likes4-5 years later
Bowser Jr's Cookie Crisp: "And if it lands perfectly on the edge, like this, not heads or tails. It just lands on the edge. You get to take it to your house."
Me: Oh my God... They brought it back!
“you cant out cookie the crisp” 😂 edit-7:04 made me laugh the song
8 likesReplies (3)
LOL
0 likesHehe
0 likesThis song is good and funny at the same time😂😂
0 likesJ.R: Lemme turn on the TV so we can watch while we eat.
16 likesADDs: ITS MY TIME
Replies (3)
subscribe to me right now why my video is going to premiere on power ranger dino fury The Official Premiere date reveal
0 likes@GamersForceRevice785 no
2 likesYou spelled ads wrong
0 likesThe Candy Salesman: He Got A PS5
4 likesBowser Junior’s Cookie Crisp: Lemme Play With Yours
Replies (1)
Sigh he probably went to school and Jackie chu said gimme the ps5 back and junior had to
0 likes13:09 "he a lil fruity" that had me so weak
40 likesReplies (4)
SML
0 likes! Thanks again
0 likes5 v v b v ♥
0 likes13:07
2 likesSoon when the song went on I just started laughing so hard🤣🤣🤣
7 likesReplies (4)
https://youtu.be/eRJ5ihFvAqE
0 likesDidnt ask
0 likeshahahahahahaha
0 likes@M z don't care
1 like2:21 when you haven’t eaten cookie crisp in years
51 likesReplies (4)
Me last time...0 omg lol
1 likei have never had cookie crisp :(
0 likesI havent ate cookie crisp in like 3 years
0 likesI haven't ate Cookie Crisp since 2020
0 likes"thats one crispy cookie"
16 likesReplies (1)
It’s a very crispy cookeh
2 likesLongest video ever, took me three days to finish.
3 likes